Sequence of A0A3R1PST4_9ZZZZ

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
nitrilotriacetate monooxygenase
A0A3R1PST4
compost metagenome
440
47579
Reaction
nitrilotriacetate + FMNH2 + H+ + O2 = iminodiacetate + glyoxylate + FMN + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A3R1PST4|nitrilotriacetate monooxygenase|EC 1.14.14.10|compost metagenome|TrEMBL
MTTKQMSLGMNILGFGSHSGAWRQGEAAIDAYIDVNYYRDIARISERGCLDAIFLADGPA
LPPDVSAQPGGRLEPTVLLTAVAAATERIGVIATCSSTYNEPFNLARRIASLDHISGGRA
AWNVVTNAGDAAAHNFGLTGAPLHVDRYGRAEEFVDVTLKLWDSWEDDAIIGDRSAGRFA
DPGKVHTLDFKGKHFQVKGPLNLPRSPQGRPVLVQAGSSEGGKALGSRYADAIFTTQTTL
ADGQAFYREMKARAKAWGRDPQHLKIMPGLSTVIGSTEAEAHARFDELNAWHGEHGLLQQ
VAGRIGIDASELDPDAPLPWARIGAVADFERGSHGFLEAQLNLARSENLTIRQLSRRILV
GHRLAVGTPEQVADTLAEWFLAGAGDGFNIMPDMFPSGARVFVEEVVPLLQKRGLFRTEY
TGTTLRDHLGLPKAHNQFAA
Download this sequence
in fasta format
Download all sequences for 1.14.14.10
in fasta format
in csv (Excel, OpenOffice) format