Sequence of DCXR_BOVIN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-xylulose reductase
Q1JP75
Bos taurus
244
25650
Reaction
xylitol + NADP+ = L-xylulose + NADPH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q1JP75|L-xylulose reductase|EC 1.1.1.10|Bos taurus|Swiss-Prot
MDLRLAGRRALVTGAGKGIGRSIVKALHAAGARVVAVSRTQADLDSLVRECPGVETVCVD
LADWEATEQALGGVGPVDLLVNNAAVAFLQPFLEVTKEAYDMSFSVNLRAVIQVSQIVAR
GLIARGAPGVIVNVSSQASQRGLTNHSVYCSTKGALDTLTKVMAVELGPHKIRVNAVNPT
VVMTPMGQAAWSDPQKAKAMLDRIPLGRFAEVENVVDTILFLLSDRSSMTTGSTVPVDGG
FLAT
Download this sequence
in fasta format
Download all sequences for 1.1.1.10
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
525440
Harhay G.P.,Sonstegard T.S.,Keele J.W.,Heaton M.P.,Clawson M.L.,Snelling W.M.,Wiedmann R.T.,Van Tassell C.P.,Smith T.P.L.
Characterization of 954 bovine full-CDS cDNA sequences.
BMC Genomics
6
166-166
2005