Sequence of A0A0U5H1K7_STRRE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
epi-isozizaene 5-monooxygenase
A0A0U5H1K7
Streptomyces reticuli
462
51723
Reaction
(+)-epi-isozizaene + 2 NADPH + 2 H+ + 2 O2 = albaflavenone + 2 NADP+ + 3 H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A0U5H1K7|epi-isozizaene 5-monooxygenase|EC 1.14.13.106|Streptomyces reticuli|TrEMBL
MSTSAQHTSPRRPATARERLARSASISKMPITEPMDRMPPGPSESVARQTVRFRRSRQHY
LTQMHDRYGDMVTLRVVPGGPFVLLRDPEHIKEVFRGAPDVFHAGEGNSLLVPIVGRHSV
LTLDAPEHRPARKRMMPPFHHERISQLVVAMQELAEREALSWPVGRPVRLLDRAYALTLD
IMVRVVFGVDDPGRAAELGAALRKVADIGLSDILVWIRPGLGRVWPWTKVVSGLERADEL
IYAEIARRRADPRRSERTDVLSMLLEGEPDDEVVRDEVMTLLVAGHETTAVALAWLFERL
VRHPRVLARVREGLDEPKDPYRTAVFKEALRVRPVIHNVARRLTEPIELGGYRLPAGVSV
LPSIGAVQCDPRLWGPDARLFRPERWLEGTPPQNAWIPFGGGARRCLGATFAQVEVETVL
AAVLRAVELRAVDPGDEGSAMNHITMIPKRGARVSVVRRLLP
Download this sequence
in fasta format
Download all sequences for 1.14.13.106
in fasta format
in csv (Excel, OpenOffice) format