Sequence of A0A2V2VY72_TRYCR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
carnitine O-acetyltransferase
A0A2V2VY72
Trypanosoma cruzi
685
77028
Reaction
acetyl-CoA + carnitine = CoA + O-acetylcarnitine
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2V2VY72|carnitine O-acetyltransferase|EC 2.3.1.7|Trypanosoma cruzi|TrEMBL
MGPHGDTASRLSQLPLPDVATLLKRYVEFLDPLDGVDGKETAVNFAQQVTRCLRGGDGEV
PPEWRGIAEYFCFLEQYAREYKRICNNLLRTSHMAALWNSFYLGNRSALPFGWNYTLYLD
GPSLEQPCQQLNISLPALRAAIIGAASFHLRRLVKNPRFFTLEGQSRLPTSCRVDLKLCR
DQLTRLFRTVRIPHLGMDGLRWSCTNKVLILRRGHPFVLDWVSFGAEDEVSGLGLRWLEE
VVANARLINAFICETSTLSLQRENPLVFSSGCRGTWARIFERLWNEGTSKAALDDITSCS
FSICLDDEMDPALSLHGGKYPENRYPDINVMYMLNPAGGASCNMEHSWGDGSTMLLVCSM
IHHYAVSFCKEYIALDRTAWINSLPDYKSHVRPVQFGSLTEDILDAIAECRQAHQRHVDN
TELTVRNICAFGRNEIKRHCRVSPEAFVHAAFHLAQRRLFGDQRSTYCALLMKKYHHGRT
ETLRTVTQETQALADLVESAENTKVFDQAVAVALQKANEEHCRRIAVCRAGEGFHRAVTF
LRRLHNVAKERFTRATSPPLASDFSKALAFVDALFFDSSSLRELSCDYLSTSNITGSGIA
SFCFTATHPDGIGIGYSLFPDHLTFAFSAHKSFARPLKGTWKNKLVDEGVAKSGGRHICQ
LYADALEQSLYDLYRLSAVLPTPKL
Download this sequence
in fasta format
Download all sequences for 2.3.1.7
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
2195379
Bradwell K.R.,Koparde V.N.,Matveyev A.V.,Serrano M.G.,Alves J.M.,Parikh H.,Huang B.,Lee V.,Espinosa-Alvarez O.,Ortiz P.A.,Costa-Martins A.G.,Teixeira M.M.,Buck G.A.
Genomic comparison of Trypanosoma conorhini and Trypanosoma rangeli to Trypanosoma cruzi strains of high and low virulence.
BMC Genomics
19
770-770
2018
2195380
Berna L.,Rodriguez M.,Chiribao M.L.,Parodi-Talice A.,Pita S.,Rijo G.,Alvarez-Valin F.,Robello C.
Expanding an expanded genome: long-read sequencing of Trypanosoma cruzi.
Microbial Genomics
0
0-0
2018