Sequence of A0A285BAB9_9ENTR

EC Number:6.2.1.35

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
acetate-[acyl-carrier protein] ligase
A0A285BAB9
Klebsiella grimontii
367
39810
Reaction
ATP + acetate + an [acyl-carrier protein] = AMP + diphosphate + an acetyl-[acyl-carrier protein]
Other sequences found for EC No. 6.2.1.35

General information:

Sequence
show sequence in normal format
>|acetate-[acyl-carrier protein] ligase|EC 6.2.1.35||
MNDPIATLEWLLEAQPGIPSLQEMPRRTLEDKGIAGPTAAHVIEEIHTPLNLALVTFTTG
SSAFQNIVGVTHDELALRTAAGKRALAACGVTAGQQVLVTYAPLVNVFTRQALDESGLRW
SFLSRSCRDALLIALCRQPPDAVVGESSFLRATLEQALKMELADRLPKKLTLITAGTPLD
EALVPLAASLGYALHDMYGCQEFGWLTLDGIPLREDISLVPAPQGGDWREAIVGGLPTGD
SFPVAAGGHLCNPQGKIQTWKRQRTTPEYDMVVMATTARHREIVERTARTILRIKGRVCH
VSTQLITEATATHIRLWPKAVPGECTAGVAPIDIIGPQATAQFDALLQSQRDLQRQAKND
PAWCKAR
Download this sequence
in fasta format
Download all sequences for 6.2.1.35
in fasta format
in csv (Excel, OpenOffice) format