Sequence of MEMB_METCA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
methane monooxygenase (soluble)
P18798
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
389
45133
Reaction
methane + NAD(P)H + H+ + O2 = methanol + NAD(P)+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>P18798|methane monooxygenase (soluble)|EC 1.14.13.25|Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)|Swiss-Prot
MSMLGERRRGLTDPEMAAVILKALPEAPLDGNNKMGYFVTPRWKRLTEYEALTVYAQPNA
DWIAGGLDWGDWTQKFHGGRPSWGNETTELRTVDWFKHRDPLRRWHAPYVKDKAEEWRYT
DRFLQGYSADGQIRAMNPTWRDEFINRYWGAFLFNEYGLFNAHSQGAREALSDVTRVSLA
FWGFDKIDIAQMIQLERGFLAKIVPGFDESTAVPKAEWTNGEVYKSARLAVEGLWQEVFD
WNESAFSVHAVYDALFGQFVRREFFQRLAPRFGDNLTPFFINQAQTYFQIAKQGVQDLYY
NCLGDDPEFSDYNRTVMRNWTGKWLEPTIAALRDFMGLFAKLPAGTTDKEEITASLYRVV
DDWIEDYASRIDFKADRDQIVKAVLAGLK
Download this sequence
in fasta format
Download all sequences for 1.14.13.25
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
675128
Stainthorpe A.C.,Murrell J.C.,Salmond G.P.C.,Dalton H.,Lees V.
Molecular analysis of methane monooxygenase from Methylococcus capsulatus (Bath).
Arch. Microbiol.
152
154-159
1989
675130
Ward N.L.,Larsen O.,Sakwa J.,Bruseth L.,Khouri H.M.,Durkin A.S.,Dimitrov G.,Jiang L.,Scanlan D.,Kang K.H.,Lewis M.R.,Nelson K.E.,Methe B.A.,Wu M.,Heidelberg J.F.,Paulsen I.T.,Fouts D.E.,Ravel J.,Tettelin H.,Ren Q.,Read T.D.,DeBoy R.T.,Seshadri R.,Salzberg S.L.,Jensen H.B.,Birkeland N.K.,Nelson W.C.,Dodson R.J.,Grindhaug S.H.,Holt I.E.,Eidhammer I.,Jonasen I.,Vanaken S.,Utterback T.R.,Feldblyum T.V.,Fraser C.M.,Lillehaug J.R.,Eisen J.A.
Genomic insights into methanotrophy: the complete genome sequence of Methylococcus capsulatus (Bath).
PLoS Biol.
2
1616-1628
2004
675131
Rosenzweig A.C.,Frederick C.A.,Lippard S.J.,Nordlund P.
Crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane.
Nature
366
537-543
1993