Sequence of I9KYU5_LACPE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
alpha-L-rhamnosidase
I9KYU5
Lactobacillus pentosus KCA1
521
59762
Reaction
hydrolysis of terminal non-reducing alpha-L-rhamnose residues in alpha-L-rhamnosides
Sequences with same EC No.
Sequence
show sequence in normal format
>I9KYU5|alpha-L-rhamnosidase|EC 3.2.1.40|Lactobacillus pentosus KCA1|TrEMBL
MSFKFQINKDVKFTRNEKFLNIAEKYKPKLVFQTHSAQRCIEIAKEDTEVRTVGQNLPIS
DLSARVMGKNDYLILDFGNHFVGHFSVGITRHGSFMDAPLTLKLQFAERPEELAYEAKNY
NGWLSSSWIPEEVIHIDQLPTRLEMPRRYSFRYVKITVLDTSPKWQISLNAPTIISESAV
DESKLPELKMADHELQKIGTISIKTLAECMQSVFEDGPKRDQRLWLGDLQLQALANYCTF
HQNSLVKRCLYLFAGVTTSDGKLSANIFTNNQVNADDTFLFDYSVFFVSCLKDYLENSDD
KQTAIDLYQTAKRQIDLASEYVDGDGKLTLPSEWPVFVDWGDDSDKSTAAQAIYIKKLQD
FMSLNALLGFETSENYVQLLNALVSYSVNDLYSQKDGLFTSNGELNIYSQIWMALAKVLP
KDKNIELMNAAYKKFFPIQNVATPYMYHFIVEALLQNEMREEGVQLIKDYWGKMVSMGAD
TFWEAFKPDEPNYSPYGSPLVNSYCHAWACTPIYLIKKYNL
Download this sequence
in fasta format
Download all sequences for 3.2.1.40
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
7819742
Anukam K.C.,Macklaim J.M.,Gloor G.B.,Reid G.,Boekhorst J.,Renckens B.,van Hijum S.A.,Siezen R.J.
Genome Sequence of Lactobacillus pentosus KCA1: Vaginal Isolate from a Healthy Premenopausal Woman.
PLoS ONE
8
0-0
2013