Sequence of A0A2G9GB56_9LAMI

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tubulin GTPase
A0A2G9GB56
Handroanthus impetiginosus
478
50601
Reaction
GTP + H2O = GDP + phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2G9GB56|tubulin GTPase|EC 3.6.5.6|Handroanthus impetiginosus|TrEMBL
MATRTYPYFAPLDTRRPTGLLTVHGAGVSLLKMVEERNGFPSVGKKCGSNFPQFKCSAYS
HNVNQFQSKDPFLNSHPEISMLRGETNSTTIKPKQDSSSGSVTESMRDSLNSNNYNAAKI
KVIGVGGGGSNAVNRMIESAMNGVEFWIVNTDVQAMKMSPVFPQHRLQIGQELTRGLGAG
GNPDVGMNAAKESKEAIEEAVYGSDMVFVTAGMGGGTGTGAAPVVAGIAKSMGILTVGIV
TTPFSFEGRKRAVQAQEGIAALRENVDTLIVIPNDKLLTAVSPSTPVTEAFNLADDILRQ
GVRGISDIIMIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDI
GIERATGIVWNITGGNDLTLFEVNAAAEVIYDLVDPSANLIFGAVVDPSLSGQVSITLIA
TGFKRQEESDGRTLQANQLTSGDSNVGLNRRPSSFLEGTSVEIPEFLRKKGRSRYPRA
Download this sequence
in fasta format
Download all sequences for 3.6.5.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
7562766
Silva-Junior O.B.,Grattapaglia D.,Novaes E.,Collevatti R.G.
Genome assembly of the Pink Ipe (Handroanthus impetiginosus, Bignoniaceae), a highly valued, ecologically keystone Neotropical timber forest tree.
Gigascience
7
1-16
2018