Sequence of GNA1_ARATH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glucosamine-phosphate N-acetyltransferase
Q9LFU9
Arabidopsis thaliana
149
17028
Reaction
acetyl-CoA + D-glucosamine 6-phosphate = CoA + N-acetyl-D-glucosamine 6-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9LFU9|glucosamine-phosphate N-acetyltransferase|EC 2.3.1.4|Arabidopsis thaliana|Swiss-Prot
MAETFKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEET
SGKIAATGSVMIEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFLMDHCKSMGCYKV
ILDCSVENKVFYEKCGMSNKSIQMSKYFD
Download this sequence
in fasta format
Download all sequences for 2.3.1.4
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
419736
Tabata S.,Kaneko T.,Nakamura Y.,Kotani H.,Kato T.,Asamizu E.,Miyajima N.,Sasamoto S.,Kimura T.,Hosouchi T.,Kawashima K.,Kohara M.,Matsumoto M.,Matsuno A.,Muraki A.,Nakayama S.,Nakazaki N.,Naruo K.,Okumura S.,Shinpo S.,Takeuchi C.,Wada T.,Watanabe A.,Yamada M.,Yasuda M.,Sato S.,de la Bastide M.,Huang E.,Spiegel L.,Gnoj L.,O'Shaughnessy A.,Preston R.,Habermann K.,Murray J.,Johnson D.,Rohlfing T.,Nelson J.,Stoneking T.,Pepin K.,Spieth J.,Sekhon M.,Armstrong J.,Becker M.,Belter E.,Cordum H.,Cordes M.,Courtney L.,Courtney W.,Dante M.,Du H.,Edwards J.,Fryman J.,Haakensen B.,Lamar E.,Latreille P.,Leonard S.,Meyer R.,Mulvaney E.,Ozersky P.,Riley A.,Strowmatt C.,Wagner-McPherson C.,Wollam A.,Yoakum M.,Bell M.,Dedhia N.,Parnell L.,Shah R.,Rodriguez M.,Hoon See L.,Vil D.,Baker J.,Kirchoff K.,Toth K.,King L.,Bahret A.,Miller B.,Marra M.A.,Martienssen R.,McCombie W.R.,Wilson R.K.,Murphy G.,Bancroft I.,Volckaert G.,Wambutt R.,Duesterhoeft A.,Stiekema W.,Pohl T.,Entian K.-D.,Terryn N.,Hartley N.,Bent E.,Johnson S.,Langham S.-A.,McCullagh B.,Robben J.,Grymonprez B.,Zimmermann W.,Ramsperger U.,Wedler H.,Balke K.,Wedler E.,Peters S.,van Staveren M.,Dirkse W.,Mooijman P.,Klein Lankhorst R.,Weitzenegger T.,Bothe G.,Rose M.,Hauf J.,Berneiser S.,Hempel S.,Feldpausch M.,Lamberth S.,Villarroel R.,Gielen J.,Ardiles W.,Bents O.,Lemcke K.,Kolesov G.,Mayer K.F.X.,Rudd S.,Schoof H.,Schueller C.,Zaccaria P.,Mewes H.-W.,Bevan M.,Fransz P.F.
Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana.
Nature
408
823-826
2000
419737
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017
419738
Nozaki M.,Sugiyama M.,Duan J.,Uematsu H.,Genda T.,Sato Y.
A missense mutation in the glucosamine-6-phosphate N-acetyltransferase-encoding gene causes temperature-dependent growth defects and ectopic lignin deposition in Arabidopsis.
Plant Cell
24
3366-3379
2012
419739
Riegler H.,Herter T.,Grishkovskaya I.,Lude A.,Ryngajllo M.,Bolger M.E.,Essigmann B.,Usadel B.
Crystal structure and functional characterization of a glucosamine-6-phosphate N-acetyltransferase from Arabidopsis thaliana.
Biochem. J.
443
427-437
2012