Sequence of J9Z1N5_TRIHA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tubulin GTPase
J9Z1N5
Trichoderma harzianum
211
23363
Reaction
GTP + H2O = GDP + phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>J9Z1N5|tubulin GTPase|EC 3.6.5.6|Trichoderma harzianum|TrEMBL
ATFSVVPSPKVSDTVVEPYNATLSMHQLVENSDETFCIDNEALYDICMRTLKLSNPSYGD
LNHLVSAVMSGVSTSLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTSPGAHSFRAV
TVPELTQQMLEPKNMMAASDFRNGRYLTCSTIFRGKVAMKEVEDQMRTVQNKNSAYFVEW
IPNNIQTALCSIPPKGLKISSTFVGNSTAIQ
Download this sequence
in fasta format
Download all sequences for 3.6.5.6
in fasta format
in csv (Excel, OpenOffice) format