Sequence of A0A2P6QCX8_ROSCH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tubulin GTPase
A0A2P6QCX8
Rosa chinensis
416
43395
Reaction
GTP + H2O = GDP + phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2P6QCX8|tubulin GTPase|EC 3.6.5.6|Rosa chinensis|TrEMBL
MATLANPNELISTTSSSIPTAFHHRNALTSPRTCIPLGTKRRSAAKRHRFGSVSCSFAPM
ETAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAENPLQIGELLTRGL
GTGGNPLLGEQAAEESKEAIAGALKGSDLVFITAGMGGGTGSGAAPVVAQISREAGYLTV
GVVTYPFSFEGRKRSVQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDV
LRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPL
IGSSIQSATGVVYNITGGKDITLQEVNKVSQVVTSLADPSANIIFGAVVDDRYTGEIHVT
IIATGFSQSFQKTLLTDPKAARLVDKVAAGQETRGIPLPLKSSTDPSRPATRKLFF
Download this sequence
in fasta format
Download all sequences for 3.6.5.6
in fasta format
in csv (Excel, OpenOffice) format