Sequence of Q96WL7_ASPFL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tubulin GTPase
Q96WL7
Aspergillus flavus
62
6616
Reaction
GTP + H2O = GDP + phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q96WL7|tubulin GTPase|EC 3.6.5.6|Aspergillus flavus|TrEMBL
QTISGEHGLDGSGVYNGSSDLQLERMNVYFNEASGNKYVPRAVLVDLEPGTMDAVRAGPF
GQ
Download this sequence
in fasta format
Download all sequences for 3.6.5.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
57842477
Okoth S.,De Boevre M.,Vidal A.,Diana Di Mavungu J.,Landschoot S.,Kyallo M.,Njuguna J.,Harvey J.,De Saeger S.
Genetic and Toxigenic Variability within Aspergillus flavus Population Isolated from Maize in Two Diverse Environments in Kenya.
Front. Microbiol.
9
57-57
2018