Sequence of G7L633_MEDTR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tubulin GTPase
G7L633
Medicago truncatula
494
52342
Reaction
GTP + H2O = GDP + phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>G7L633|tubulin GTPase|EC 3.6.5.6|Medicago truncatula|TrEMBL
MSLDTVRMASCFAPTNSRNSAGVLAVNGGRKLLENHHINKSCFVKIHENKFAFSSVNNRK
CGLFQVKSTGLPNSHSVSPYHHSKDPFLDLHPEISMLRGEGSSGLNNSTRPRKDTSGGDV
MEGLEDNLTPSNYNEAKIKVIGVGGGGSNAVNRMIESSMNGVEFWIVNTDVQAMRMSPVN
SENRLPIGQELTRGLGAGGNPEIGMNAAKESKDSIQEAVYGADMVFVTAGMGGGTGTGAA
PVIAGITKSMGILTVGIVTTPFSFEGRRRAVQAQEGIAALRDNVDTLIVIPNDKLLTAVS
QSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGK
TRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIF
GAVIDPSLSGQVSITLIATGFKRQEESEARPVQANQLTQGDTVVSRRSSTFTDGSLVEIP
EFLKKKGRLRYPRA
Download this sequence
in fasta format
Download all sequences for 3.6.5.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
57550380
Young N.D.,Debelle F.,Oldroyd G.E.D.,Geurts R.,Cannon S.B.,Udvardi M.K.,Benedito V.A.,Mayer K.F.X.,Gouzy J.,Schoof H.,Van de Peer Y.,Proost S.,Cook D.R.,Meyers B.C.,Spannagl M.,Cheung F.,De Mita S.,Krishnakumar V.,Gundlach H.,Zhou S.,Mudge J.,Bharti A.K.,Murray J.D.,Naoumkina M.A.,Rosen B.,Silverstein K.A.T.,Tang H.,Rombauts S.,Zhao P.X.,Zhou P.,Barbe V.,Bardou P.,Bechner M.,Bellec A.,Berger A.,Berges H.,Bidwell S.,Bisseling T.,Choisne N.,Couloux A.,Denny R.,Deshpande S.,Dai X.,Doyle J.J.,Dudez A.-M.,Farmer A.D.,Fouteau S.,Franken C.,Gibelin C.,Gish J.,Goldstein S.,Gonzalez A.J.,Green P.J.,Hallab A.,Hartog M.,Hua A.,Humphray S.J.,Jeong D.-H.,Jing Y.,Jocker A.,Kenton S.M.,Kim D.-J.,Klee K.,Lai H.,Lang C.,Lin S.,Macmil S.L.,Magdelenat G.,Matthews L.,McCorrison J.,Monaghan E.L.,Mun J.-H.,Najar F.Z.,Nicholson C.,Noirot C.,O'Bleness M.,Paule C.R.,Poulain J.,Prion F.,Qin B.,Qu C.,Retzel E.F.,Riddle C.,Sallet E.,Samain S.,Samson N.,Sanders I.,Saurat O.,Scarpelli C.,Schiex T.,Segurens B.,Severin A.J.,Sherrier D.J.,Shi R.,Sims S.,Singer S.R.,Sinharoy S.,Sterck L.,Viollet A.,Wang B.-B.,Wang K.,Wang M.,Wang X.,Warfsmann J.,Weissenbach J.,White D.D.,White J.D.,Wiley G.B.,Wincker P.,Xing Y.,Yang L.,Yao Z.,Ying F.,Zhai J.,Zhou L.,Zuber A.,Denarie J.,Dixon R.A.,May G.D.,Schwartz D.C.,Rogers J.,Quetier F.,Town C.D.,Roe B.A.
The Medicago genome provides insight into the evolution of rhizobial symbioses.
Nature
480
520-524
2011
57550381
Tang H.,Krishnakumar V.,Bidwell S.,Rosen B.,Chan A.,Zhou S.,Gentzbittel L.,Childs K.L.,Yandell M.,Gundlach H.,Mayer K.F.,Schwartz D.C.,Town C.D.
An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
BMC Genomics
15
312-312
2014
57550383
Pecrix Y.,Staton S.E.,Sallet E.,Lelandais-Briere C.,Moreau S.,Carrere S.,Blein T.,Jardinaud M.F.,Latrasse D.,Zouine M.,Zahm M.,Kreplak J.,Mayjonade B.,Satge C.,Perez M.,Cauet S.,Marande W.,Chantry-Darmon C.,Lopez-Roques C.,Bouchez O.,Berard A.,Debelle F.,Munos S.,Bendahmane A.,Berges H.,Niebel A.,Buitink J.,Frugier F.,Benhamed M.,Crespi M.,Gouzy J.,Gamas P.
Whole-genome landscape of Medicago truncatula symbiotic genes.
Nat. Plants
4
1017-1025
2018