Sequence of TRYGT_DROER

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
trypsin
C0HKA6
Drosophila erecta
253
25965
Reaction
preferential cleavage: Arg-/-, Lys-/-
Sequences with same EC No.
Sequence
show sequence in normal format
>C0HKA6|trypsin|EC 3.4.21.4|Drosophila erecta|Swiss-Prot
MLKFVILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSI
YTDRVIVTAAHCLQSVSTSSLQIRAGSSYWNSGGVTVKVSSFKNHEGYSARTMVNDIAVI
RLSSSLSFSSTIKSISLASSNPPNGAAASVSGWGTQSSGSNSIPSQLQYVNVNIVSQSRC
ASSTYGYGSDIRDTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGQGCAYSNYPGVYA
SVADLRAWVVRNA
Download this sequence
in fasta format
Download all sequences for 3.4.21.4
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
234300
Wang S.,Magoulas C.,Hickey D.A.
Concerted evolution within a trypsin gene cluster in Drosophila.
Mol. Biol. Evol.
16
1117-1124
1999