Sequence of SSUD_BACVZ

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
alkanesulfonate monooxygenase
A7Z2Q3
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)
378
41734
Reaction
an alkanesulfonate + FMNH2 + O2 = an aldehyde + FMN + sulfite + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A7Z2Q3|alkanesulfonate monooxygenase|EC 1.14.14.5|Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)|Swiss-Prot
MEILWFIPTHGDGRYLGTQTGGRTADHLYFKQVAQAADRLGYTGVLLPTGRSCEDPWLTA
AALAGETSDLKFLVAVRPGLMQPSVAARMASTMDRLSDGRLLVNVVAGGDPYELAGDGMF
ISHDERYKATEEFLTVWRGLMRGETVTYEGDHIKVENSNLLFPPKQSPHPPLYFGGSSQA
GIEAAAKHTDVYLTWGEPPEQVKEKIETVKKQAAKEGRTMRFGIRLHVIVRETEEEAWEA
AERLISHLDEETIAKAQAALRRADSSGQKRMAGLHNGDRSKLEISPNLWAGIGLVRGGAG
TALVGDPQTVATRILEYQALGIESFIFSGYPHLEEAYYLAELVFPLLPFQNERTKKLERR
LGEAMGNDHFARGKKAKV
Download this sequence
in fasta format
Download all sequences for 1.14.14.5
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
224392
Chen X.H.,Koumoutsi A.,Scholz R.,Eisenreich A.,Schneider K.,Heinemeyer I.,Morgenstern B.,Voss B.,Hess W.R.,Reva O.,Junge H.,Voigt B.,Jungblut P.R.,Vater J.,Suessmuth R.,Liesegang H.,Strittmatter A.,Gottschalk G.,Borriss R.
Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42.
Nat. Biotechnol.
25
1007-1014
2007