Sequence of SSUD_AGRFC

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
alkanesulfonate monooxygenase
Q8UAE8
Agrobacterium fabrum (strain C58 / ATCC 33970)
389
41763
Reaction
an alkanesulfonate + FMNH2 + O2 = an aldehyde + FMN + sulfite + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>Q8UAE8|alkanesulfonate monooxygenase|EC 1.14.14.5|Agrobacterium fabrum (strain C58 / ATCC 33970)|Swiss-Prot
MSKHDKPLDFLWFIPTSGDGSYLGSDDLSRPADPGYFREIAQAADRLGYSGVLIPTGVAC
EESFILAANLAAYTEKLKFLVAIRPGVASPAYYARLASTLDRVSHGRLLLNIVVGGSAQE
LAGDGIFLPHDERYDHADEFFQVFNSLIETGKGDLDGKYIKAQGARLGLPPVQEPRPPLY
FGGSSDAGIEFSAGITDKYLTWGEPPAQVAEKIVKVRAAAAKNGREVTFGIRLHFIVRET
DEEAWADADRLISKLSDETIASAQEVFSKASDSVGQARMQALHNGRRDKLEVSPNLWAGI
GLVRSGAGTALVGSPKTVAARLREYQALGIDTVIASGYPHLEEAYRLSELLFPEIGIDGP
RNQIRSSFGAKQVFGGGGHGGNVKLVSGS
Download this sequence
in fasta format
Download all sequences for 1.14.14.5
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
224384
Wood D.W.,Setubal J.C.,Kaul R.,Monks D.E.,Kitajima J.P.,Okura V.K.,Zhou Y.,Chen L.,Wood G.E.,Almeida N.F. Jr.,Woo L.,Chen Y.,Paulsen I.T.,Eisen J.A.,Karp P.D.,Bovee D. Sr.,Chapman P.,Clendenning J.,Deatherage G.,Gillet W.,Grant C.,Kutyavin T.,Levy R.,Li M.-J.,McClelland E.,Palmieri A.,Raymond C.,Rouse G.,Saenphimmachak C.,Wu Z.,Romero P.,Gordon D.,Zhang S.,Yoo H.,Tao Y.,Biddle P.,Jung M.,Krespan W.,Perry M.,Gordon-Kamm B.,Liao L.,Kim S.,Hendrick C.,Zhao Z.-Y.,Dolan M.,Chumley F.,Tingey S.V.,Tomb J.-F.,Gordon M.P.,Olson M.V.,Nester E.W.
The genome of the natural genetic engineer Agrobacterium tumefaciens C58.
Science
294
2317-2323
2001
224385
Goodner B.,Hinkle G.,Gattung S.,Miller N.,Blanchard M.,Qurollo B.,Goldman B.S.,Cao Y.,Askenazi M.,Halling C.,Mullin L.,Houmiel K.,Gordon J.,Vaudin M.,Iartchouk O.,Epp A.,Liu F.,Wollam C.,Allinger M.,Doughty D.,Scott C.,Lappas C.,Markelz B.,Flanagan C.,Crowell C.,Gurson J.,Lomo C.,Sear C.,Strub G.,Cielo C.,Slater S.
Genome sequence of the plant pathogen and biotechnology agent Agrobacterium tumefaciens C58.
Science
294
2323-2328
2001