Sequence of SSUD2_RHILO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
alkanesulfonate monooxygenase
Q98DT4
Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
385
42486
Reaction
an alkanesulfonate + FMNH2 + O2 = an aldehyde + FMN + sulfite + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>Q98DT4|alkanesulfonate monooxygenase|EC 1.14.14.5|Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)|Swiss-Prot
MTSPPSPLDFFWFIPTHGDGSYLGSEEQQRPPEFGYFKQIAQAVDRLGFPGVLLPTGQNC
EDSWITATGLATLTEKLKFLVALRPGVTLPTFAARQTAALDRLSNGRLLLNVVVGGNPTE
LAGDGVFLPHDERYAQAHEFLTIWRGLVSGERVNFDGKYYRVENGRLDLLPSQERPPLYF
GGSSDAGQDLAADLVDMYLTWGEPPALVAEKLASARKKAALRGRKLRFGIRLHFIVRETE
DEAWRAADRLISHVTDAQIENAQARFLNQMDSVGQRRMAELHGGRRDRLVVSPNLWAGVG
LVRGGAGTALVGTPEQVTERIREYQAIGIDTIIGSGYPHLEEAYRVAELLFPRLGLGTRR
QQAHRDIANEFSVGFHGAARLQASS
Download this sequence
in fasta format
Download all sequences for 1.14.14.5
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
224382
Kaneko T.,Nakamura Y.,Sato S.,Asamizu E.,Kato T.,Sasamoto S.,Watanabe A.,Idesawa K.,Ishikawa A.,Kawashima K.,Kimura T.,Kishida Y.,Kiyokawa C.,Kohara M.,Matsumoto M.,Matsuno A.,Mochizuki Y.,Nakayama S.,Nakazaki N.,Shimpo S.,Sugimoto M.,Takeuchi C.,Yamada M.,Tabata S.
Complete genome structure of the nitrogen-fixing symbiotic bacterium Mesorhizobium loti.
DNA Res.
7
331-338
2000