Sequence of CYSI_ACTP7

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
assimilatory sulfite reductase (NADPH)
B3GZ95
Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
588
66663
Reaction
hydrogen sulfide + 3 NADP+ + 3 H2O = sulfite + 3 NADPH + 3 H+
Sequences with same EC No.
Sequence
show sequence in normal format
>B3GZ95|assimilatory sulfite reductase (NADPH)|EC 1.8.1.2|Actinobacillus pleuropneumoniae serotype 7 (strain AP76)|Swiss-Prot
MSDKKTKGLEWQEKPLSDNERLKTDSNFLRGTILDDLKDGLTGGFKGDNFQLIRFHGMYE
QDDRDIRAERLEEKLEPLKFMLLRCRLPGGIIKPYQWIEIDKFAREHTRYQSIRLTNRQT
FQYHGVPKGKLQPMHRLLHSIGLDSIATAADMNRNVLCTSNPIESELHQQAYEFAKKISE
HLLPRSRGYLDVWVDGKKVESSDDLLKIEDEPILGKTYLPRKFKTAVAIPPLNDVDVYAN
DLNFIAIQDENGQLCGFNVLVGGGLSFEHGNTKTYPNVAYSLGFVPLEHTLAAAEGVVKT
QRDFGNRSDRKNARVRYTIQNMTLDGFRAEVERCMNIKFEPTRPYEFTERGDRIGWVKGI
DNNWHLTLFIESGRITDKPEKPLMTGVLELAKVHKGDFRITANQNLIVANVAEQDKAQIE
AIARQYGLIQEISKLRENAMSCVSLPTCPLAMAEAERVLPDFISELDKVLSKHNVADESI
ITRITGCPNGCGRAMLAEIGLVGKAIGRYNLHIGGDRAGLRISRLYKENITLQEIVNEID
QLVARWATERQTNEAFGDFVIRSNIIAPVVNAHIDFWDATKIIPTTII
Download this sequence
in fasta format
Download all sequences for 1.8.1.2
in fasta format
in csv (Excel, OpenOffice) format