Sequence of A1WR57_VEREI

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
methane monooxygenase (soluble)
A1WR57
Verminephrobacter eiseniae (strain EF01-2)
556
64748
Reaction
methane + NAD(P)H + H+ + O2 = methanol + NAD(P)+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A1WR57|methane monooxygenase (soluble)|EC 1.14.13.25|Verminephrobacter eiseniae (strain EF01-2)|TrEMBL
MSDGLTLNKITSQRGISIGEAARRIADLGWTPSYVQEAMTFPTDYKISKAPRDPMKQVLR
SYFPMQEEKDNRVYGALDAALRGDMFRNVEPRWIEWMKLFLAIIPFPEISAARSMAMLGR
LAPGEELRTGFTMQMVDEFRHSTIQMNLKKWYMENYIDPAGFDITEAAFGKCYATTIGRQ
FAEGFLTGDAVTAANVFLQVVAETAFTNTLFVAMPSEAARNGDYALPTVFLSVQSDESRH
IGNGHSLVMSIINDPDNHLLLERDLRYAFWQNHAIVDAAIGTFIEYGTVDRDKNKESYAE
LWHRWIYEDYYRTYMLPLEKYGIKIHHDDIVAAWDRIVKQNYVHKVAQFFAVGWPVNFWR
IEAQTEKDFEWFEHKYPGWYAEFGDFWKWYAKKSVPGQTNMLFDQECGYVYPHRCWSCLV
PCLIREDFVVDEVDGQIYTYCSEMCHWTHKVAFASEYEGRPTPAMGRFSGRREWEECYHG
WDLADCIKDLGFVRSDGKTLVPQPHLRFDDRNMWTLDHVRGHMIQSPIVLLRNMTPQQRE
KHIAEYRAGFKINPVN
Download this sequence
in fasta format
Download all sequences for 1.14.13.25
in fasta format
in csv (Excel, OpenOffice) format