Sequence of MMOC_METTR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
methane monooxygenase (soluble)
Q53563
Methylosinus trichosporium
340
37991
Reaction
methane + NAD(P)H + H+ + O2 = methanol + NAD(P)+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>Q53563|methane monooxygenase (soluble)|EC 1.14.13.25|Methylosinus trichosporium|Swiss-Prot
MYQIVIETEDGETCRRMRPSEDWISRAEAERNLLASCRAGCATCKADCTDGDYELIDVKV
QAVPPDEEEDGKVLLCRTFPRSDLHLLVPYTYDRISFEAIQTNWLAEILACDRVSSNVVR
LVLQRSRPMAARISLNFVPGQFVDIEIPGTHTRRSYSMASVAEDGQLEFIIRLLPDGAFS
KFLQTEAKVGMRVDLRGPAGSFFLHDHGGRSRVFVAGGTGLSPVLSMIRQLGKASDPSPA
TLLFGVTNREELFYVDELKTLAQSMPTLGVRIAVVNDDGGNGVDKGTVIDLLRAELEIDL
LLGHARRRRRRETARSCREDHRDRCPAWRSDFLEKFLASG
Download this sequence
in fasta format
Download all sequences for 1.14.13.25
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
183750
Cardy D.L.N.,Laidler V.,Salmond G.P.C.,Murrell J.C.
The methane monooxygenase gene cluster of Methylosinus trichosporium: cloning and sequencing of the mmoC gene.
Arch. Microbiol.
156
477-483
1991
183751
Fox B.G.,Liu Y.,Dege J.E.,Lipscomb J.D.
Complex formation between the protein components of methane monooxygenase from Methylosinus trichosporium OB3b. Identification of sites of component interaction.
J. Biol. Chem.
266
540-550
1991