Sequence of MMOC_METCA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
methane monooxygenase (soluble)
P22868
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
348
38542
Reaction
methane + NAD(P)H + H+ + O2 = methanol + NAD(P)+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>P22868|methane monooxygenase (soluble)|EC 1.14.13.25|Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)|Swiss-Prot
MQRVHTITAVTEDGESLRFECRSDEDVITAALRQNIFLMSSCREGGCATCKALCSEGDYD
LKGCSVQALPPEEEEEGLVLLCRTYPKTDLEIELPYTHCRISFGEVGSFEAEVVGLNWVS
SNTVQFLLQKRPDECGNRGVKFEPGQFMDLTIPGTDVSRSYSPANLPNPEGRLEFLIRVL
PEGRFSDYLRNDARVGQVLSVKGPLGVFGLKERGMAPRYFVAGGTGLAPVVSMVRQMQEW
TAPNETRIYFGVNTEPELFYIDELKSLERSMRNLTVKACVWHPSGDWEGEQGSPIDALRE
DLESSDANPDIYLCGPPGMIDAACELVRSRGIPGEQVFFEKFLPSGAA
Download this sequence
in fasta format
Download all sequences for 1.14.13.25
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
183746
Stainthorpe A.C.,Lees V.,Salmond G.P.C.,Dalton H.,Murrell J.C.
The methane monooxygenase gene cluster of Methylococcus capsulatus (Bath).
Gene
91
27-34
1990
183748
Ward N.L.,Larsen O.,Sakwa J.,Bruseth L.,Khouri H.M.,Durkin A.S.,Dimitrov G.,Jiang L.,Scanlan D.,Kang K.H.,Lewis M.R.,Nelson K.E.,Methe B.A.,Wu M.,Heidelberg J.F.,Paulsen I.T.,Fouts D.E.,Ravel J.,Tettelin H.,Ren Q.,Read T.D.,DeBoy R.T.,Seshadri R.,Salzberg S.L.,Jensen H.B.,Birkeland N.K.,Nelson W.C.,Dodson R.J.,Grindhaug S.H.,Holt I.E.,Eidhammer I.,Jonasen I.,Vanaken S.,Utterback T.R.,Feldblyum T.V.,Fraser C.M.,Lillehaug J.R.,Eisen J.A.
Genomic insights into methanotrophy: the complete genome sequence of Methylococcus capsulatus (Bath).
PLoS Biol.
2
1616-1628
2004
183749
Mueller J.,Lugovskoy A.A.,Wagner G.,Lippard S.J.
NMR structure of the [2Fe-2S] ferredoxin domain from soluble methane monooxygenase reductase and interaction with its hydroxylase.
Biochemistry
41
42-51
2002