Sequence of A0A4U9SWS4_CLODI

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
nitrilotriacetate monooxygenase
A0A4U9SWS4
Clostridioides difficile
446
49220
Reaction
nitrilotriacetate + FMNH2 + H+ + O2 = iminodiacetate + glyoxylate + FMN + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A4U9SWS4|nitrilotriacetate monooxygenase|EC 1.14.14.10|Clostridioides difficile|TrEMBL
MTKQVHLAAHFPGVNNTTVWSDPASGSQIEFDSFVHLAQTAERGKFDFFFLAEGLRLREQ
NGLIYDLDVVGRPDTFTVLSALAAVTTHLGLTGTINSTFNEPVDVARQFATLDHLSAGRA
AWNVVTSWDEFTGENFRRGGYLPEDQRYARAKEFLTAAATLWDSWRDDDVLADTSSGRFL
AREEAGKFDFTSSQFDIHGHFPTPRPPQGRPVIFQAGDSDEGREFAAATADAIFSRHATY
DAGRDFYTDVKRRLASHGRRPEELLVLPAATFVVGDTDAQAAELAHEVRLQQVSGQTAIK
FLEQLWNRDLSAHDPDGPLPQEDPVPGENTVAKGRASVRMHRDPVAVAREWRDLAEAKNL
TTRELIIEVTGRQSFVGSPLTVAHTINDFVQADVADGFILVPHIVPGGLDRFVDEVVPVL
QELGVYRIDYEGTTLRDNLGLAHPAG
Download this sequence
in fasta format
Download all sequences for 1.14.14.10
in fasta format
in csv (Excel, OpenOffice) format