Sequence of A0A448GFM4_MYCCH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
nitrilotriacetate monooxygenase
A0A448GFM4
Mycobacterium chelonae
427
47297
Reaction
nitrilotriacetate + FMNH2 + H+ + O2 = iminodiacetate + glyoxylate + FMN + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A448GFM4|nitrilotriacetate monooxygenase|EC 1.14.14.10|Mycobacterium chelonae|TrEMBL
MQHGVSSHSVGMWRHPQDKVGWDYAKPPYWQHLARTLERGLFDAVFLADELAPYNSFEDS
SDATIRYAVQAPTHEPAALTPIITGATEHLGVGITLSTAFEHPYSMARRLSTYDHLSGGR
IAWNIVGSYSPSEFAAYGQQMPDRSIRYERIAEYVDLCCRLWDSWQPDAIVADRETGIYA
HPEKVAEVNFEGKFFRCRARHFVAPSPQGRPVLWQAGASEPGRQFAASTAEAIFAIQPTV
SSMRAYSDDIRRRVEQAGRDPGAVKLYYGAQVIVGTTEAQAREKADYLRSLLRPEATLAM
LSGQLGVDFSQFDPDTPLQDIPVPGIQGVKDALVATGAGETVTVAEAAEIYSFRFSMPQV
IGTPAAVADQLEVFLDEGDADGFMLLATYTPGCFEEFVDLVVPELQRRGRYRTRYPGTTL
RENILAD
Download this sequence
in fasta format
Download all sequences for 1.14.14.10
in fasta format
in csv (Excel, OpenOffice) format