Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A484RFT6_9ZZZZ

EC Number:1.5.1.29

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
FMN reductase
A0A484RFT6
plant metagenome
193
21164
Reaction
Other sequences found for EC No. 1.5.1.29

General information:

Sequence
show sequence in normal format
>A0A484RFT6|FMN reductase|EC 1.5.1.29|plant metagenome|TrEMBL
MTRPLRLVAVSGGLQRPSKAAALAAHLLDLIGREAPCEQRLIELGQLAPQFAGATWRPQL
PDAVERELAAVEQADVLVVTTPVFRGTYTGLFKHFFDFIHQDALVDKPVLLAATGGSERH
ALMIDHQLRPLFSFFQARTLPLGVYATDKDFTDYRLRDEALIQRADLAVQRALPVIDLAR
QTLSATPGMAVAA
Download this sequence
in fasta format
Download all sequences for 1.5.1.29
in fasta format
in csv (Excel, OpenOffice) format