Sequence of A0A2P1ERL5_9BACT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
methane monooxygenase (soluble)
A0A2P1ERL5
uncultured candidate division NC10 bacterium
115
13414
Reaction
methane + NAD(P)H + H+ + O2 = methanol + NAD(P)+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2P1ERL5|methane monooxygenase (soluble)|EC 1.14.13.25|uncultured candidate division NC10 bacterium|TrEMBL
QYFMWEKMRLPIGATFCVMTLHFGQWMNRVFNFYYWAWFPVNFTTPGLMIPSAIVLDVTL
MMTGSYMFTALFGGMAWSLLFYPANWTWLAPFHLAVKHPSGPLMTIADLMGMEYV
Download this sequence
in fasta format
Download all sequences for 1.14.13.25
in fasta format
in csv (Excel, OpenOffice) format