Sequence of E0VY59_PEDHC

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
choline O-acetyltransferase
E0VY59
Pediculus humanus subsp. corporis
650
74164
Reaction
acetyl-CoA + choline = CoA + O-acetylcholine
Sequences with same EC No.
Sequence
show sequence in normal format
>E0VY59|choline O-acetyltransferase|EC 2.3.1.6|Pediculus humanus subsp. corporis|TrEMBL
MTSIINSNSKKDLFLLASYFRRLNGNIILHMSSASSVLSQSKTETPPTKTEIMRFPVQPL
KETLQKYIESVKPFVNEEELTNTKKIVDNFSEPNNIGTVLQSLLEFRAKNIENWLSDWWL
DTAYLEYRDPVVVYSSPGLVWPAKNFQSEHERICYAATIIHSALLFNILLEKKKLPQDML
GSFPLCMNQYYKIFGTCRIPDLPKDKLLFQDPKNPSTNILVIYNNQFFSINAFKNDTRNP
LSINTFYTMLLDIVENNCSEDVEYPVGVLTTENRDNWAEAYKELKRNDINKDILENYIEK
ALFVVCLDKPLPNNNSSYDTKCSKLLLHGCGSKYNAGNRWYDKTIQFIFGCGSDGVGVAY
EHSPAEGGPIGVLTDYVLLKEGKISNSQYKFEKVEDYPLPQKLEFCLNDNIKEAITKAKV
AVNKISSTLNVNSFSFFKFGKNEIKKLKVSPDSFIQVAIQYAFHELHKHPGAQYESGSLR
RFVNGRTDTIRTCSEDVLKFCQKMSEANASKDEKKEALLKALSSHKKYAKEVVEGKGIDR
HLLGLKILAKINGVENLNLFNDVAYQRSTYFQLSTSNVPVKCNGFMVYGPLVKDGYACCY
NPRDNNINFGMTAWFNSDKTNLNEFRKNLCEALMNMKCCLENDETVKSKL
Download this sequence
in fasta format
Download all sequences for 2.3.1.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1869327
Kirkness E.F.,Haas B.J.,Sun W.,Braig H.R.,Perotti M.A.,Clark J.M.,Lee S.H.,Robertson H.M.,Kennedy R.C.,Elhaik E.,Gerlach D.,Kriventseva E.V.,Elsik C.G.,Graur D.,Hill C.A.,Veenstra J.A.,Walenz B.,Tubio J.M.,Ribeiro J.M.,Rozas J.,Johnston J.S.,Reese J.T.,Popadic A.,Tojo M.,Raoult D.,Reed D.L.,Tomoyasu Y.,Krause E.,Mittapalli O.,Margam V.M.,Li H.M.,Meyer J.M.,Johnson R.M.,Romero-Severson J.,Vanzee J.P.,Alvarez-Ponce D.,Vieira F.G.,Aguade M.,Guirao-Rico S.,Anzola J.M.,Yoon K.S.,Strycharz J.P.,Unger M.F.,Christley S.,Lobo N.F.,Seufferheld M.J.,Wang N.,Dasch G.A.,Struchiner C.J.,Madey G.,Hannick L.I.,Bidwell S.,Joardar V.,Caler E.,Shao R.,Barker S.C.,Cameron S.,Bruggner R.V.,Regier A.,Johnson J.,Viswanathan L.,Utterback T.R.,Sutton G.G.,Lawson D.,Waterhouse R.M.,Venter J.C.,Strausberg R.L.,Berenbaum M.R.,Collins F.H.,Zdobnov E.M.,Pittendrigh B.R.
Genome sequences of the human body louse and its primary endosymbiont provide insights into the permanent parasitic lifestyle.
Proc. Natl. Acad. Sci. U.S.A.
107
12168-12173
2010