Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A7W6S987_9HYPH

EC Number:1.1.1.29

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycerate dehydrogenase
A0A7W6S987
Rhizobium cellulosilyticum
317
34573
Reaction
D-glycerate + NAD+ = hydroxypyruvate + NADH + H+
Other sequences found for EC No. 1.1.1.29

General information:

Sequence
show sequence in normal format
>A0A7W6S987|glycerate dehydrogenase|EC 1.1.1.29|Rhizobium cellulosilyticum|TrEMBL
MTKIVFLDRDTIGPAVTITRPSFPHEWVEYGKTPETEVAGRIREADIVITNKAPVREASI
KAAPKLKMITVAATGYDVIDLAFAKERGIVVSNVRGYAVNTVPEHTFALIFALRRSIVGF
REDVIAGEWQRANQFCFFNHPIRDLANSTIGIFGGGTLGQSVARIAKALGMKVMFAGRKG
AAKAAEGYTPFETVLEEADIITLHMPLKPETRDLIGIEEFRRMKRHPLIINTARGGLVNE
ADLVTALDEGLIAGAGFDVLTKEPPAADNPLLIVLDRPNVILTPHVAWASDEAMQALWAQ
VIGHVENFEKGTPSNAL
Download this sequence
in fasta format
Download all sequences for 1.1.1.29
in fasta format
in csv (Excel, OpenOffice) format