Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A0H5BDD6_BLAVI

EC Number:1.1.1.29

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycerate dehydrogenase
A0A0H5BDD6
Blastochloris viridis
332
36098
Reaction
D-glycerate + NAD+ = hydroxypyruvate + NADH + H+
Other sequences found for EC No. 1.1.1.29

General information:

Sequence
show sequence in normal format
>A0A0H5BDD6|glycerate dehydrogenase|EC 1.1.1.29|Blastochloris viridis|TrEMBL
MPAKTKPLVIVTRALPAAVETRLRELFDARLNDDDHPMSQAELAAAVASADVLVPTVTDR
IDTAVLSHAGPNLKLIASFGTGVDHIDVQVAMSRGITVTNTPGVLTDDTADMTMALILAV
PRRLVEGLEVLQHGEWPGWAPTWMLGRRIAGKRLGIVGMGRIGSAVARRARAFGMQIHYH
NRRRLPAVVEQSLEATYWESLDQMLARVDIVSVNCPHTPATYHLLSARRLKLLKKDAYIV
NTARGGVVDEAALIRMVEAGELAGAGLDVFENEPALNPKLIKLARAGRIVILPHMGSATL
EGRIDMGEKVIVNIKTFIDGHRPPDRVLLSML
Download this sequence
in fasta format
Download all sequences for 1.1.1.29
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1510692
Liu L.N.,Faulkner M.,Liu X.,Huang F.,Darby A.C.,Hall N.
Revised genome sequence of the purple photosynthetic bacterium Blastochloris viridis.
Genome Announc.
4
0-0
2016