Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A812ASL3_SEPPH

EC Number:1.1.1.45

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-gulonate 3-dehydrogenase
A0A812ASL3
Sepia pharaonis
196
21886
Reaction
L-gulonate + NAD+ = 3-dehydro-L-gulonate + NADH + H+
Other sequences found for EC No. 1.1.1.45

General information:

Sequence
show sequence in normal format
>A0A812ASL3|L-gulonate 3-dehydrogenase|EC 1.1.1.45|Sepia pharaonis|TrEMBL
MLDLETFPICFFIFISIYLSIYLSVAVRAYRCANICSFSLSLSLSLSLSLSLSLFSCFFF
FSFSLSLLILFLLLSFPHSLLTLSLSHYPSFFSVLLLQSLLPSLLLFLLLSPNFLLTPSY
MISRFLTRWLFLLLSQSCILSHPLNPSHYRFQSNLSPSLSPLSPSQTLSSLSLSLSLSLS
LSVCPSVCVSPSHVHS
Download this sequence
in fasta format
Download all sequences for 1.1.1.45
in fasta format
in csv (Excel, OpenOffice) format