Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of DHGY_METEA

EC Number:1.1.1.29

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycerate dehydrogenase
Q59516
Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
314
34269
Reaction
D-glycerate + NAD+ = hydroxypyruvate + NADH + H+
Other sequences found for EC No. 1.1.1.29

General information:

Sequence
show sequence in normal format
>Q59516|glycerate dehydrogenase|EC 1.1.1.29|Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)|Swiss-Prot
MTKKVVFLDRESLDATVREFNFPHEYKEYESTWTPEEIVERLQGAEIAMINKVPMRADTL
KQLPDLKLIAVAATGTDVVDKAAAKAQGITVVNIRNYAFNTVPEHVVGLMFALRRAIVPY
ANSVRRGDWNKSKQFCYFDYPIYDIAGSTLGIIGYGALGKSIAKRAEALGMKVLAFDVFP
QDGLVDLETILTQSDVITLHVPLTPDTKNMIGAEQLKKMKRSAILINTARGGLVDEAALL
QALKDGTIGGAGFDVVAQEPPKDGNILCDADLPNLIVTPHVAWASKEAMQILADQLVDNV
EAFVAGKPQNVVEA
Download this sequence
in fasta format
Download all sequences for 1.1.1.29
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1177845
Chistoserdova L.V.,Lidstrom M.E.
Genetics of the serine cycle in Methylobacterium extorquens AM1: identification of sgaA and mtdA and sequences of sgaA, hprA, and mtdA.
J. Bacteriol.
176
1957-1968
1994
1177846
Vuilleumier S.,Chistoserdova L.,Lee M.-C.,Bringel F.,Lajus A.,Zhou Y.,Gourion B.,Barbe V.,Chang J.,Cruveiller S.,Dossat C.,Gillett W.,Gruffaz C.,Haugen E.,Hourcade E.,Levy R.,Mangenot S.,Muller E.,Nadalig T.,Pagni M.,Penny C.,Peyraud R.,Robinson D.G.,Roche D.,Rouy Z.,Saenampechek C.,Salvignol G.,Vallenet D.,Wu Z.,Marx C.J.,Vorholt J.A.,Olson M.V.,Kaul R.,Weissenbach J.,Medigue C.,Lidstrom M.E.
Methylobacterium genome sequences: a reference blueprint to investigate microbial metabolism of C1 compounds from natural and industrial sources.
PLoS ONE
4
0-0
2009
1177847
Chistoserdova L.V.,Lidstrom M.E.
Cloning, mutagenesis, and physiological effect of a hydroxypyruvate reductase gene from Methylobacterium extorquens AM1.
J. Bacteriol.
174
71-77
1992
1177848
Chistoserdova L.V.,Lidstrom M.E.
Purification and characterization of hydroxypyruvate reductase from the facultative methylotroph Methylobacterium extorquens AM1.
J. Bacteriol.
173
7228-7232
1991