Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of DHGY_HYPME

EC Number:1.1.1.29

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycerate dehydrogenase
P36234
Hyphomicrobium methylovorum
322
35115
Reaction
D-glycerate + NAD+ = hydroxypyruvate + NADH + H+
Other sequences found for EC No. 1.1.1.29

General information:

Sequence
show sequence in normal format
>P36234|glycerate dehydrogenase|EC 1.1.1.29|Hyphomicrobium methylovorum|Swiss-Prot
MSKKKILITWPLPEAAMARARESYDVIAHGDDPKITIDEMIETAKSVDALLITLNEKCRK
EVIDRIPENIKCISTYSIGFDHIDLDACKARGIKVGNAPHGVTVATAEIAMLLLLGSARR
AGEGEKMIRTRSWPGWEPLELVGEKLDNKTLGIYGFGSIGQALAKRAQGFDMDIDYFDTH
RASSSDEASYQATFHDSLDSLLSVSQFFSLNAPSTPETRYFFNKATIKSLPQGAIVVNTA
RGDLVDNELVVAALEAGRLAYAGFDVFAGEPNINEGYYDLPNTFLFPHIGSAATQAREDM
AHQANDLIDALFGGADMSYALA
Download this sequence
in fasta format
Download all sequences for 1.1.1.29
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1177843
Goldberg J.D.,Yoshida T.,Brick P.
Crystal structure of a NAD-dependent D-glycerate dehydrogenase at 2.4-A resolution.
J. Mol. Biol.
236
1123-1140
1994
1177844
Izumi Y.,Yoshida T.,Kanzaki H.,Toki S.,Miyazaki S.S.,Yamada H.
Purification and characterization of hydroxypyruvate reductase from a serine-producing methylotroph, Hyphomicrobium methylovorum GM2.
Eur. J. Biochem.
190
279-284
1990