Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of DHGY_CUCSA

EC Number:1.1.1.29

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycerate dehydrogenase
P13443
Cucumis sativus
382
41706
Reaction
D-glycerate + NAD+ = hydroxypyruvate + NADH + H+
Other sequences found for EC No. 1.1.1.29

General information:

Sequence
show sequence in normal format
>P13443|glycerate dehydrogenase|EC 1.1.1.29|Cucumis sativus|Swiss-Prot
MAKPVQIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTEKKTILSVEDILALIG
DKCDGVIGQLTEDWGEVLFSALSRAGGKAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLT
ETTAELAASLSLAAARRIVEADEFMRAGRYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAY
ARMMVEGFKMNLIYFDLYQSTRLEKFVTAYGEFLKANGEAPVTWRRASSMDEVLREADVI
SLHPVLDKTTFHLVNKESLKAMKKDAILINCSRGPVIDEAALVDHLRDNPMFRVGLDVFE
DEPYMKPGLADMKNAIIVPHIASASKWTREGMATLAALNVLGKIKGYPVWSDPNRVEPFL
DENVSPPAASPSIVNAKALGNA
Download this sequence
in fasta format
Download all sequences for 1.1.1.29
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1177841
Greenler J.M.,Sloan J.S.,Schwartz B.W.,Becker W.M.
Isolation, characterization and sequence analysis of a full-length cDNA clone encoding NADH-dependent hydroxypyruvate reductase from cucumber.
Plant Mol. Biol.
13
139-150
1989
1177842
Schwartz B.W.,Sloan J.S.,Becker W.M.
Characterization of genes encoding hydroxypyruvate reductase in cucumber.
Plant Mol. Biol.
17
941-947
1991