Sequence of ADPRH_BOVIN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
[protein ADP-ribosylarginine] hydrolase
Q32KR8
Bos taurus
353
39152
Reaction
Nomega-(ADP-D-ribosyl)-L-arginine + H2O = ADP-D-ribose + L-arginine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q32KR8|[protein ADP-ribosylarginine] hydrolase|EC 3.2.2.19|Bos taurus|Swiss-Prot
MCGALMERYVAAMVLSAAGDALGYFNGKWEFLQNGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALLEAGKVSDLTHLYSLLAKHYQDCMGDMDGRAPGGASVQNAMLLEPDKA
DGWRIPFNSHEGGCGAAMRAMCIGLRFPHSSQLDSLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQQWGRGLMEVLPEAKKYIVQSGFFVEQNLQHWSYFQDQWEKYLKLRG
IWDGKSAPTFPKPFDVKERDQFYSSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLR
Download this sequence
in fasta format
Download all sequences for 3.2.2.19
in fasta format
in csv (Excel, OpenOffice) format