Sequence of CLAT_CAEEL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
choline O-acetyltransferase
P32756
Caenorhabditis elegans
627
71317
Reaction
acetyl-CoA + choline = CoA + O-acetylcholine
Sequences with same EC No.
Sequence
show sequence in normal format
>P32756|choline O-acetyltransferase|EC 2.3.1.6|Caenorhabditis elegans|Swiss-Prot
MEKEKVDELPPNDNWYETALPKPPVPSLEATLDRYLEYAAVVAVGQKASLATTHDAAHKF
VRQATPLQEQLLEIAEKSPNWATKFWLPEMYMRVRMPTPVNSNPGYIFPKVKFETKEDHI
KYTALLTRGLLEYKNLIDTKQVCREKSTGAQKLQMCMEQYDRVLSCYREPGVGEDTQIRK
QKTNDGNEHVLVMCRNQTFLLHSRINGALVSYADVEYQLAQIEEISKINQNNTANIGASG
VGPRDNAALFWQDMLTVEQNSKSYEWVKSALFVVCLDMEDPIDYGKNDTMSISEKEKEFV
ARGYSTLTGHGSSKFGLNRWYDATIQLVVSSSGVNGLCIEHSTAEGIVIINMAETAIRYA
QKYFKSKMVWNDVRNVHPKSLTWHFSENSRNILKKQAEVFDELANELELEVLIFNEFGKD
SIKNWRVSPDGFIQLIMQLAHYKTHGHLVSTYESASVRRFGAGRVDNIRANTQEALEWVT
AMASKKESKERKLELFKKAVLKQVKVTLENISGYGVDNHLCALFCLAREREETTGEDIPS
LFLDPLWSEVMRFPLSTSQVTTSLDIPDCYLTYGAVVRDGYGCPYNIQPDRVIFAPTAFR
SDPRTDLQHFKKSLAGAMRDVKELLSN
Download this sequence
in fasta format
Download all sequences for 2.3.1.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
872555
Alfonso A.,Grundahl K.,McManus J.R.,Rand J.B.
Cloning and characterization of the choline acetyltransferase structural gene (cha-1) from C. elegans.
J. Neurosci.
14
2290-2300
1994
872556
Genome sequence of the nematode C. elegans: a platform for investigating biology.
Science
282
2012-2018
1998
872557
Schwarz J.,Bringmann H.
Analysis of the NK2 homeobox gene ceh-24 reveals sublateral motor neuron control of left-right turning during sleep.
Elife
6
0-0
2017