Sequence of A0A084GGF1_9PEZI

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
lactase
A0A084GGF1
Scedosporium apiospermum
417
48232
Reaction
lactose + H2O = D-galactose + D-glucose
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A084GGF1|lactase|EC 3.2.1.108|Scedosporium apiospermum|TrEMBL
MVNVFAKTIADDPKYRGVLPADFLHGYASAAYQVEGGASEGGRGPCLWDVALQKYPDNGE
EACMSYHLWEEDIKLLQRYGARSYRFSISWSRIKPLGGKDTPINERGVEYYNHLIDGLIR
AGIEPTVTLFHYDTPQALQDRYRGFAAVDPAELIEDFVEYARVCFQRFGDRVKRWLTINE
PYIWAIHMFDHLENWTKADFMRSATVKGTQTDGWDAWGDLFLRFSDEELKLVQGSSDFFS
INHYGTMYATGKPYTEADSIGWQTMDEVNKTWVKEGKLIGKRGENGHPHNVGWGFRKLLV
HCWEEYVKKLDMPIYVYENGFPVEHEAEMPLEQIIDDKDRQQFYSDYIQGLCDAVLDHGV
KIEGYHCWSLLDNLEWTCGYTPRFGVTYVDKENGFKRIPKNSAKSVQAIWNHVVRKE
Download this sequence
in fasta format
Download all sequences for 3.2.1.108
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
200406664
Vandeputte P.,Ghamrawi S.,Rechenmann M.,Iltis A.,Giraud S.,Fleury M.,Thornton C.,Delhaes L.,Meyer W.,Papon N.,Bouchara J.P.
Draft Genome Sequence of the Pathogenic Fungus Scedosporium apiospermum.
Genome Announc.
2
0-0
2014
200422794
Vandeputte P.,Ghamrawi S.,Rechenmann M.,Iltis A.,Giraud S.,Fleury M.,Thornton C.,Delhaes L.,Meyer W.,Papon N.,Bouchara J.P.
Draft Genome Sequence of the Pathogenic Fungus Scedosporium apiospermum.
Genome Announc.
2
0-0
2014