Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A1V2MJV6_9ACTN

EC Number:2.5.1.2

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
thiamine pyridinylase
A0A1V2MJV6
Streptomyces sp. IB2014 011-1
436
46455
Reaction
thiamine + pyridine = 1-[(4-amino-2-methylpyrimidin-5-yl)methyl]pyridinium + 4-methyl-5-(2-hydroxyethyl)thiazole
Other sequences found for EC No. 2.5.1.2

General information:

Sequence
show sequence in normal format
>|thiamine pyridinylase|EC 2.5.1.2||
MPHRMIRARRTRLTFFSAGVTSLALLASACGGGGTSAAPKEFKYLSVTENTTTRTALTKL
SKGSCKAENDTLPLKVETVPQASLDQKLQLLAGQDALPAQFAAGNAPALTKQLAESGKVA
NLDIELERLGVFDDLEPAAVSTIKALYDGKVQTLPYEYNIEGIFYNKKIFKEKGIEVPGT
WDELIAASDKLNTKGVQPFAASGQQGWPITRLISGYLYRSLGPGALDDVNTGLAQLTEPE
YVKAAEEIAALGKKGYFGKGVGSIDYDTAMNQFLTGKSAMFYMGSWALANISDPKQNKVG
ADNVGFMPFPAVTGGAGSADQYPSNVGLAVTLGSKNFDKKTDAWVRCIAKNYGSTALKDH
GSISGFKVNTPVKDANEVTTTVRKTISSSQQNVLWFEAFFSTKATTASQTNAAGLVTGSV
SPKQFMETVQSALKSK
Download this sequence
in fasta format
Download all sequences for 2.5.1.2
in fasta format
in csv (Excel, OpenOffice) format