Sequence of LXRA_ASPNA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-xylulose reductase
G3YG17
Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
298
31924
Reaction
xylitol + NADP+ = L-xylulose + NADPH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>G3YG17|L-xylulose reductase|EC 1.1.1.10|Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)|Swiss-Prot
MSRSLEGKFAIITGGSRGIGEAIAHNLASKGCSLLLNYTSDSSRTRTESLCNTLSTTHKI
TCIPVQADLSDPAPAVNTIISAAKTHFTSPTTNTLTIDILINNAGVSKDRFLNDPSSGPI
DPAYFNWHYTINVLAPLLLTQACAEYLPRKPAHSGRIINISSISSSLGFTGQSVYGGTKA
ALEAMTRTWARELADVATVNAVNPGPVVGDMYFATGEEFWKQMQGFQDNTPLSKLVDGEE
AVEELLSEEQKRLIREKMGGRRPAFTREIAGVVGMLCTEDGAWCTGSVVCANGGLKFT
Download this sequence
in fasta format
Download all sequences for 1.1.1.10
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
677224
Andersen M.R.,Salazar M.P.,Schaap P.J.,van de Vondervoort P.J.I.,Culley D.,Thykaer J.,Frisvad J.C.,Nielsen K.F.,Albang R.,Albermann K.,Berka R.M.,Braus G.H.,Braus-Stromeyer S.A.,Corrochano L.M.,Dai Z.,van Dijck P.W.M.,Hofmann G.,Lasure L.L.,Magnuson J.K.,Menke H.,Meijer M.,Meijer S.L.,Nielsen J.B.,Nielsen M.L.,van Ooyen A.J.J.,Pel H.J.,Poulsen L.,Samson R.A.,Stam H.,Tsang A.,van den Brink J.M.,Atkins A.,Aerts A.,Shapiro H.,Pangilinan J.,Salamov A.,Lou Y.,Lindquist E.,Lucas S.,Grimwood J.,Grigoriev I.V.,Kubicek C.P.,Martinez D.,van Peij N.N.M.E.,Roubos J.A.,Nielsen J.,Baker S.E.
Comparative genomics of citric-acid-producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88.
Genome Res.
21
885-897
2011
677225
Mojzita D.,Vuoristo K.,Koivistoinen O.M.,Penttilae M.,Richard P.
The 'true' L-xylulose reductase of filamentous fungi identified in Aspergillus niger.
FEBS Lett.
584
3540-3544
2010