Sequence of MEMG_METTR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
methane monooxygenase (soluble)
P27355
Methylosinus trichosporium
169
19326
Reaction
methane + NAD(P)H + H+ + O2 = methanol + NAD(P)+ + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>P27355|methane monooxygenase (soluble)|EC 1.14.13.25|Methylosinus trichosporium|Swiss-Prot
MAKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERK
IEEKLSVLKTEKLPVADLITKATTGEDRAAVEATWIAKIKAAKSKYEADGIHIEFRQLYK
PPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKEPGVKVLHLQA
Download this sequence
in fasta format
Download all sequences for 1.14.13.25
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
675140
Cardy D.L.N.,Laidler V.,Salmond G.P.C.,Murrell J.C.
Molecular analysis of the methane monooxygenase (MMO) gene cluster of Methylosinus trichosporium OB3b.
Mol. Microbiol.
5
335-342
1991
675141
Fox B.G.,Liu Y.,Dege J.E.,Lipscomb J.D.
Complex formation between the protein components of methane monooxygenase from Methylosinus trichosporium OB3b. Identification of sites of component interaction.
J. Biol. Chem.
266
540-550
1991