Sequence of NB5R4_HUMAN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
cytochrome-b5 reductase
Q7L1T6
Homo sapiens
521
59474
Reaction
NADH + 2 ferricytochrome b5 = NAD+ + H+ + 2 ferrocytochrome b5
Sequences with same EC No.
Sequence
show sequence in normal format
>Q7L1T6|cytochrome-b5 reductase|EC 1.6.2.2|Homo sapiens|Swiss-Prot
MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEE
ELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESM
LKECLVGRMAIKPAVLKDYREEEKKVLNGMLPKSQVTDTLAKEGPSYPSYDWFQTDSLVT
IAIYTKQKDINLDSIIVDHQNDSFRAETIIKDCLYLIHIGLSHEVQEDFSVRVVESVGKI
EIVLQKKENTSWDFLGHPLKNHNSLIPRKDTGLYYRKCQLISKEDVTHDTRLFCLMLPPS
THLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYFLIKIYPTGLF
TPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDIPSLR
KVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLK
RNLDKSKVLVCICGPVPFTEQGVRLLHDLNFSKNEIHSFTA
Download this sequence
in fasta format
Download all sequences for 1.6.2.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
59467
Mungall A.J.,Palmer S.A.,Sims S.K.,Edwards C.A.,Ashurst J.L.,Wilming L.,Jones M.C.,Horton R.,Hunt S.E.,Scott C.E.,Gilbert J.G.R.,Clamp M.E.,Bethel G.,Milne S.,Ainscough R.,Almeida J.P.,Ambrose K.D.,Andrews T.D.,Ashwell R.I.S.,Babbage A.K.,Bagguley C.L.,Bailey J.,Banerjee R.,Barker D.J.,Barlow K.F.,Bates K.,Beare D.M.,Beasley H.,Beasley O.,Bird C.P.,Blakey S.E.,Bray-Allen S.,Brook J.,Brown A.J.,Brown J.Y.,Burford D.C.,Burrill W.,Burton J.,Carder C.,Carter N.P.,Chapman J.C.,Clark S.Y.,Clark G.,Clee C.M.,Clegg S.,Cobley V.,Collier R.E.,Collins J.E.,Colman L.K.,Corby N.R.,Coville G.J.,Culley K.M.,Dhami P.,Davies J.,Dunn M.,Earthrowl M.E.,Ellington A.E.,Evans K.A.,Faulkner L.,Francis M.D.,Frankish A.,Frankland J.,French L.,Garner P.,Garnett J.,Ghori M.J.,Gilby L.M.,Gillson C.J.,Glithero R.J.,Grafham D.V.,Grant M.,Gribble S.,Griffiths C.,Griffiths M.N.D.,Hall R.,Halls K.S.,Hammond S.,Harley J.L.,Hart E.A.,Heath P.D.,Heathcott R.,Holmes S.J.,Howden P.J.,Howe K.L.,Howell G.R.,Huckle E.,Humphray S.J.,Humphries M.D.,Hunt A.R.,Johnson C.M.,Joy A.A.,Kay M.,Keenan S.J.,Kimberley A.M.,King A.,Laird G.K.,Langford C.,Lawlor S.,Leongamornlert D.A.,Leversha M.,Lloyd C.R.,Lloyd D.M.,Loveland J.E.,Lovell J.,Martin S.,Mashreghi-Mohammadi M.,Maslen G.L.,Matthews L.,McCann O.T.,McLaren S.J.,McLay K.,McMurray A.,Moore M.J.F.,Mullikin J.C.,Niblett D.,Nickerson T.,Novik K.L.,Oliver K.,Overton-Larty E.K.,Parker A.,Patel R.,Pearce A.V.,Peck A.I.,Phillimore B.J.C.T.,Phillips S.,Plumb R.W.,Porter K.M.,Ramsey Y.,Ranby S.A.,Rice C.M.,Ross M.T.,Searle S.M.,Sehra H.K.,Sheridan E.,Skuce C.D.,Smith S.,Smith M.,Spraggon L.,Squares S.L.,Steward C.A.,Sycamore N.,Tamlyn-Hall G.,Tester J.,Theaker A.J.,Thomas D.W.,Thorpe A.,Tracey A.,Tromans A.,Tubby B.,Wall M.,Wallis J.M.,West A.P.,White S.S.,Whitehead S.L.,Whittaker H.,Wild A.,Willey D.J.,Wilmer T.E.,Wood J.M.,Wray P.W.,Wyatt J.C.,Young L.,Younger R.M.,Bentley D.R.,Coulson A.,Durbin R.M.,Hubbard T.,Sulston J.E.,Dunham I.,Rogers J.,Beck S.
The DNA sequence and analysis of human chromosome 6.
Nature
425
805-811
2003
59468
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
Genome Res.
14
2121-2127
2004
59469
Zhu H.,Qiu H.,Yoon H.-W.,Huang S.,Bunn H.F.
Identification of a cytochrome b-type NAD(P)H oxidoreductase ubiquitously expressed in human cells.
Proc. Natl. Acad. Sci. U.S.A.
96
14742-14747
1999
59470
Van Damme P.,Lasa M.,Polevoda B.,Gazquez C.,Elosegui-Artola A.,Kim D.S.,De Juan-Pardo E.,Demeyer K.,Hole K.,Larrea E.,Timmerman E.,Prieto J.,Arnesen T.,Sherman F.,Gevaert K.,Aldabe R.
N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
Proc. Natl. Acad. Sci. U.S.A.
109
12449-12454
2012
59471
Deng B.,Parthasarathy S.,Wang W.,Gibney B.R.,Battaile K.P.,Lovell S.,Benson D.R.,Zhu H.
Study of the individual cytochrome b5 and cytochrome b5 reductase domains of Ncb5or reveals a unique heme pocket and a possible role of the CS domain.
J. Biol. Chem.
285
30181-30191
2010
59472
Andersen G.,Wegner L.,Rose C.S.,Xie J.,Zhu H.,Larade K.,Johansen A.,Ek J.,Lauenborg J.,Drivsholm T.,Borch-Johnsen K.,Damm P.,Hansen T.,Bunn H.F.,Pedersen O.
Variation in NCB5OR: studies of relationships to type 2 diabetes, maturity-onset diabetes of the young, and gestational diabetes mellitus.
Diabetes
53
2992-2997
2004
59473
Zhu H.,Larade K.,Jackson T.A.,Xie J.,Ladoux A.,Acker H.,Berchner-Pfannschmidt U.,Fandrey J.,Cross A.R.,Lukat-Rodgers G.S.,Rodgers K.R.,Bunn H.F.
NCB5OR is a novel soluble NAD(P)H reductase localized in the endoplasmic reticulum.
J. Biol. Chem.
279
30316-30325
2004
59474
Sjoeblom T.,Jones S.,Wood L.D.,Parsons D.W.,Lin J.,Barber T.D.,Mandelker D.,Leary R.J.,Ptak J.,Silliman N.,Szabo S.,Buckhaults P.,Farrell C.,Meeh P.,Markowitz S.D.,Willis J.,Dawson D.,Willson J.K.V.,Gazdar A.F.,Hartigan J.,Wu L.,Liu C.,Parmigiani G.,Park B.H.,Bachman K.E.,Papadopoulos N.,Vogelstein B.,Kinzler K.W.,Velculescu V.E.
The consensus coding sequences of human breast and colorectal cancers.
Science
314
268-274
2006