Sequence of MUG_SALA4

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
double-stranded uracil-DNA glycosylase
B5F6A8
Salmonella agona (strain SL483)
168
18650
Reaction
Specifically hydrolyses mismatched double-stranded DNA and polynucleotides, releasing free uracil
Sequences with same EC No.
Sequence
show sequence in normal format
>B5F6A8|double-stranded uracil-DNA glycosylase|EC 3.2.2.28|Salmonella agona (strain SL483)|Swiss-Prot
MVKDILAPGLRVVFCGINPGLSSANTGFPFAHPANRFWKVIHLAGFTDRQLKPEEAEKLL
DFRCGVTKLVDRPTVQATEVKLHELRSGGRNLIEKIEDYQPAALAVLGKQAFEQGFSQRG
IAWGKQKIAIGATMVWVLPNPSGLNRIKTEKLVEAYRELDQALIMRGL
Download this sequence
in fasta format
Download all sequences for 3.2.2.28
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
56749
Fricke W.F.,Mammel M.K.,McDermott P.F.,Tartera C.,White D.G.,Leclerc J.E.,Ravel J.,Cebula T.A.
Comparative genomics of 28 Salmonella enterica isolates: evidence for CRISPR-mediated adaptive sublineage evolution.
J. Bacteriol.
193
3556-3568
2011