Sequence of TC10A_ARATH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
3-dehydrosphinganine reductase
Q0WRJ2
Arabidopsis thaliana
326
34980
Reaction
sphinganine + NADP+ = 3-dehydrosphinganine + NADPH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q0WRJ2|3-dehydrosphinganine reductase|EC 1.1.1.102|Arabidopsis thaliana|Swiss-Prot
MAAISPLFLLFLIPIIPLSLLAILALIVRPRPIKIPIKSRHAFITGGSSGIGLALAHRAA
SEGARVSILARSGSKLEEAKKSIQLATGVEVATFSADVRDYDAVSKAIDESGPIDVLIVN
QGVFTAKELVKHSPEDVKFTIDVNLVGSFNVIKAALPAMKARKDRGPASISLVSSQAGQV
GVYGYAAYSASKFGLQGLAQALQQEVISDDIHVTLIFPPDTNTPGFEEEQKSRPEVTAII
AASSGSMETEEVAKKAMDGIKAGNFTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAG
PIRLIALFFQWDWYKAIEKWSKTKTK
Download this sequence
in fasta format
Download all sequences for 1.1.1.102
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
599392
Salanoubat M.,Lemcke K.,Rieger M.,Ansorge W.,Unseld M.,Fartmann B.,Valle G.,Bloecker H.,Perez-Alonso M.,Obermaier B.,Delseny M.,Boutry M.,Grivell L.A.,Mache R.,Puigdomenech P.,De Simone V.,Choisne N.,Artiguenave F.,Robert C.,Brottier P.,Wincker P.,Cattolico L.,Weissenbach J.,Saurin W.,Quetier F.,Schaefer M.,Mueller-Auer S.,Gabel C.,Fuchs M.,Benes V.,Wurmbach E.,Drzonek H.,Erfle H.,Jordan N.,Bangert S.,Wiedelmann R.,Kranz H.,Voss H.,Holland R.,Brandt P.,Nyakatura G.,Vezzi A.,D'Angelo M.,Pallavicini A.,Toppo S.,Simionati B.,Conrad A.,Hornischer K.,Kauer G.,Loehnert T.-H.,Nordsiek G.,Reichelt J.,Scharfe M.,Schoen O.,Bargues M.,Terol J.,Climent J.,Navarro P.,Collado C.,Perez-Perez A.,Ottenwaelder B.,Duchemin D.,Cooke R.,Laudie M.,Berger-Llauro C.,Purnelle B.,Masuy D.,de Haan M.,Maarse A.C.,Alcaraz J.-P.,Cottet A.,Casacuberta E.,Monfort A.,Argiriou A.,Flores M.,Liguori R.,Vitale D.,Mannhaupt G.,Haase D.,Schoof H.,Rudd S.,Zaccaria P.,Mewes H.-W.,Mayer K.F.X.,Kaul S.,Town C.D.,Koo H.L.,Tallon L.J.,Jenkins J.,Rooney T.,Rizzo M.,Walts A.,Utterback T.,Fujii C.Y.,Shea T.P.,Creasy T.H.,Haas B.,Maiti R.,Wu D.,Peterson J.,Van Aken S.,Pai G.,Militscher J.,Sellers P.,Gill J.E.,Feldblyum T.V.,Preuss D.,Lin X.,Nierman W.C.,Salzberg S.L.,White O.,Venter J.C.,Fraser C.M.,Kaneko T.,Nakamura Y.,Sato S.,Kato T.,Asamizu E.,Sasamoto S.,Kimura T.,Idesawa K.,Kawashima K.,Kishida Y.,Kiyokawa C.,Kohara M.,Matsumoto M.,Matsuno A.,Muraki A.,Nakayama S.,Nakazaki N.,Shinpo S.,Takeuchi C.,Wada T.,Watanabe A.,Yamada M.,Yasuda M.,Tabata S.
Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.
Nature
408
820-822
2000
599393
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017
599394
Yamada K.,Lim J.,Dale J.M.,Chen H.,Shinn P.,Palm C.J.,Southwick A.M.,Wu H.C.,Kim C.J.,Nguyen M.,Pham P.K.,Cheuk R.F.,Karlin-Newmann G.,Liu S.X.,Lam B.,Sakano H.,Wu T.,Yu G.,Miranda M.,Quach H.L.,Tripp M.,Chang C.H.,Lee J.M.,Toriumi M.J.,Chan M.M.,Tang C.C.,Onodera C.S.,Deng J.M.,Akiyama K.,Ansari Y.,Arakawa T.,Banh J.,Banno F.,Bowser L.,Brooks S.Y.,Carninci P.,Chao Q.,Choy N.,Enju A.,Goldsmith A.D.,Gurjal M.,Hansen N.F.,Hayashizaki Y.,Johnson-Hopson C.,Hsuan V.W.,Iida K.,Karnes M.,Khan S.,Koesema E.,Ishida J.,Jiang P.X.,Jones T.,Kawai J.,Kamiya A.,Meyers C.,Nakajima M.,Narusaka M.,Seki M.,Sakurai T.,Satou M.,Tamse R.,Vaysberg M.,Wallender E.K.,Wong C.,Yamamura Y.,Yuan S.,Shinozaki K.,Davis R.W.,Theologis A.,Ecker J.R.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science
302
842-846
2003
599396
Chao D.Y.,Gable K.,Chen M.,Baxter I.,Dietrich C.R.,Cahoon E.B.,Guerinot M.L.,Lahner B.,Lu S.,Markham J.E.,Morrissey J.,Han G.,Gupta S.D.,Harmon J.M.,Jaworski J.G.,Dunn T.M.,Salt D.E.
Sphingolipids in the root play an important role in regulating the leaf ionome in Arabidopsis thaliana.
Plant Cell
23
1061-1081
2011