Sequence of MQMTN_HELPJ

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
aminodeoxyfutalosine nucleosidase
Q9ZMY2
Helicobacter pylori (strain J99 / ATCC 700824)
230
25020
Reaction
6-amino-6-deoxyfutalosine + H2O = dehypoxanthine futalosine + adenine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9ZMY2|aminodeoxyfutalosine nucleosidase|EC 3.2.2.30|Helicobacter pylori (strain J99 / ATCC 700824)|Swiss-Prot
MQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLT
TTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIF
IETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVA
FVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Download this sequence
in fasta format
Download all sequences for 3.2.2.30
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
559907
Alm R.A.,Ling L.-S.L.,Moir D.T.,King B.L.,Brown E.D.,Doig P.C.,Smith D.R.,Noonan B.,Guild B.C.,deJonge B.L.,Carmel G.,Tummino P.J.,Caruso A.,Uria-Nickelsen M.,Mills D.M.,Ives C.,Gibson R.,Merberg D.,Mills S.D.,Jiang Q.,Taylor D.E.,Vovis G.F.,Trust T.J.
Genomic sequence comparison of two unrelated isolates of the human gastric pathogen Helicobacter pylori.
Nature
397
176-180
1999
559908
Ronning D.R.,Iacopelli N.M.,Mishra V.
Enzyme-ligand interactions that drive active site rearrangements in the Helicobacter pylori 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase.
Protein Sci.
19
2498-2510
2010
559909
Wang S.,Haapalainen A.M.,Yan F.,Du Q.,Tyler P.C.,Evans G.B.,Rinaldo-Matthis A.,Brown R.L.,Norris G.E.,Almo S.C.,Schramm V.L.
A picomolar transition state analogue inhibitor of MTAN as a specific antibiotic for Helicobacter pylori.
Biochemistry
51
6892-6894
2012