Sequence of MQMTN_CAMJE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
aminodeoxyfutalosine nucleosidase
Q0PC20
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
229
25225
Reaction
6-amino-6-deoxyfutalosine + H2O = dehypoxanthine futalosine + adenine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q0PC20|aminodeoxyfutalosine nucleosidase|EC 3.2.2.30|Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)|Swiss-Prot
MMKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFAKYKNHELVLAYSKIGKVNSTLSA
SVMIEKFGAQALLFTGVAGAFNPELEIGDLLYATKLAQYDLDITAFGHPLGFVPGNEIFI
KTDEKLNNLALEVAKELNIKLRAGIIATGDEFICDEAKKAKIREIFNADACEMEGASVAL
VCDALKVPCFILRAMSDKAGEKAEFDFDEFVINSAKISANFVLKMCEKL
Download this sequence
in fasta format
Download all sequences for 3.2.2.30
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
559905
Parkhill J.,Wren B.W.,Mungall K.L.,Ketley J.M.,Churcher C.M.,Basham D.,Chillingworth T.,Davies R.M.,Feltwell T.,Holroyd S.,Jagels K.,Karlyshev A.V.,Moule S.,Pallen M.J.,Penn C.W.,Quail M.A.,Rajandream M.A.,Rutherford K.M.,van Vliet A.H.M.,Whitehead S.,Barrell B.G.
The genome sequence of the food-borne pathogen Campylobacter jejuni reveals hypervariable sequences.
Nature
403
665-668
2000
559906
Li X.,Apel D.,Gaynor E.C.,Tanner M.E.
5'-methylthioadenosine nucleosidase is implicated in playing a key role in a modified futalosine pathway for menaquinone biosynthesis in Campylobacter jejuni.
J. Biol. Chem.
286
19392-19398
2011