Sequence of LPH_RAT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
lactase
Q02401
Rattus norvegicus
1928
217268
Reaction
lactose + H2O = D-galactose + D-glucose
Sequences with same EC No.
Sequence
show sequence in normal format
>Q02401|lactase|EC 3.2.1.108|Rattus norvegicus|Swiss-Prot
MELPWTALFLSTVLLGLSCQGSDWESDRNFISAAGPLTNDLVLNLNYPPGKQGSDVVSGN
TDHLLCQQPLPSFLSQYFSSLRASQVTHYKVLLSWAQLLPTGSSKNPDQEAVQCYRQLLQ
SLKDAQLEPMVVLCHQTPPTSSAIQREGAFADLFADYATLAFQSFGDLVEIWFTFSDLEK
VIMDLPHKDLKASALQTLSNAHRRAFEIYHRKFSSQGGKLSVVLKAEDIPELLPDPALAA
LVQGSVDFLSLDLSYECQSVATLPQKLSELQNLEPKVKVFIYTLKLEDCPATGTSPSSLL
ISLLEAINKDQIQTVGFDVNAFLSCTSNSEESPSCSLTDSLALQTEQQQETAVPSSPGSA
YQRVWAAFANQSREERDAFLQDVFPEGFLWGISTGAFNVEGGWAEGGRGPSIWDHYGNLN
AAEGQATAKVASDSYHKPASDVALLRGIRAQVYKFSISWSGLFPLGQKSTPNRQGVAYYN
KLIDRLLDSHIEPMATLFHWDLPQALQEQGGWQNESVVEAFLDYAAFCFSTFGDRVKLWV
TFHEPWVMSYAGYGTGQHAPAISDPGMASFKVAHLILKAHARTWHLYDLHHRLQQQGRVG
IVLNSDLAEPLDRKSPQDLAAAERFLHFMLGWFAHPIFVDGDYPTTSAQIQHINQQCGHP
LAQLPEFTEAEKRLLKGSADFLGLSHYTSRLISKAGRQTCTSSYDNIGGFSQHVDPEWPQ
TASPWIRVVPWGIRRLLRFASMEYTKGKLPIFLAGNGMPVGEEADLFDDSVRVNYFNWYI
NEVLKAVKEDLVDVRSYIVRSLIDGYEGPLGFSQRFGLYHVNFNDSSRPRTPRKSAYLFT
SIIEKNGFSAKKVKRNPLPVRADFTSRARVTDSLPSEVPSKAKISVEKFSKQPRFERDLF
YDGRFRDDFLWGVSSSPYQIEGGWNADGKGPSIWDNFTHTPGNGVKDNATGDVACDSYHQ
LDADLNILRTLKVKSYRFSISWSRIFPTGRNSTINKQGVDYYNRLIDSLVDNNIFPMVTL
FHWDLPQALQDIGGWENPSLIELFDSYADYCFKTFGDRVKFWMTFNEPWCHVVLGYSSGI
FPPSVQEPGWLPYKVSHIVIKAHARVYHTYDEKYRSEQKGVISLSLNTHWAEPKDPGLQR
DVEAADRMLQFTMGWFAHPIFKNGDYPDVMKWTVGNRSELQHLASSRLPTFTEEEKNYVR
GTADVFCHNTYTSVFVQHSTPRLNPPSYDDDMELKLIEMNSSTGVMHQDVPWGTRRLLNW
IKEEYGNIPIYITENGQGLENPTLDDTERIFYHKTYINEALKAYKLDGVDLRGYSAWTLM
DDFEWLLGYTMRFGLYYVDFNHVSRPRTARASARYYPDLIANNGMPLAREDEFLYGEFPK
GFIWSAASASYQVEGAWRADGKGLSIWDTFSHTPLRIGNDDNGDVACDSYHKIAEDVVAL
QNLGVSHYRFSIAWSRILPDGTTKFINEAGLSYYVRFIDALLAAGITPQVTIYHWDLPQA
LQDVGGWENETIVQRFKEYADVLFQRLGDRVKFWITLNEPFVIAAQGYGTGVSAPGISFR
PGTAPYIAGHNLIKAHAEAWHLYNDVYRARQGGTISITISSDWGEPRDPTNREHVEAARS
YVQFMGGWFAHPIFKNGDYPEVMKTRIRDRSLGAGLNKSRLPEFTESEKSRIKGTFDFFG
FNHNTTVLAYNLDYPAAFSSFDADRGVASIADSSWPVSGSFWLKVTPFGFRRILNWLKEE
YNNPPIYVTENGVSRRGEPELNDTDRIYYLRSYINEALKAVHDKVDLRGYTVWSIMDNFE
WATGFAERFGVHFVNRSDPSLPRIPRASAKFYATIVRCNGFPDPAQGPHPCLQQPEDAAP
TASPVQSEVPFLGLMLGIAEAQTALYVLFALLLLGACSLAFLTYNTGRRSKQGNAQPSQH
QLSPISSF
Download this sequence
in fasta format
Download all sequences for 3.2.1.108
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
50242
Duluc I.,Boukamel R.,Mantei N.,Semenza G.,Raul F.,Freund J.-N.
Sequence of the precursor of intestinal lactase-phlorizin hydrolase from fetal rat.
Gene
103
275-276
1991
50243
Boukamel R.,Freund J.-N.
The rat LPH gene 5' region: comparative structure with the human gene.
DNA Seq.
3
119-121
1992
50244
Bueller H.A.,Kothe M.J.,Goldman D.A.,Grubman S.A.,Sasak W.V.,Matsudaira P.T.,Montgomery R.K.,Grand R.J.
Coordinate expression of lactase-phlorizin hydrolase mRNA and enzyme levels in rat intestine during development.
J. Biol. Chem.
265
6978-6983
1990