Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of CRYL1_HUMAN

EC Number:1.1.1.45

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-gulonate 3-dehydrogenase
Q9Y2S2
Homo sapiens
319
35419
Reaction
L-gulonate + NAD+ = 3-dehydro-L-gulonate + NADH + H+
Other sequences found for EC No. 1.1.1.45

General information:

Sequence
show sequence in normal format
>Q9Y2S2|L-gulonate 3-dehydrogenase|EC 1.1.1.45|Homo sapiens|Swiss-Prot
MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAG
SLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILS
SSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIG
QCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLET
MHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKVNQDMCMKVPDDPEHLAARRQ
WRDECLMRLAKLKSQVQPQ
Download this sequence
in fasta format
Download all sequences for 1.1.1.45
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
530514
Chen J.,Yu L.,Li D.,Gao Q.,Wang J.,Huang X.,Bi G.,Wu H.,Zhao S.
Human CRYL1, a novel enzyme-crystallin overexpressed in liver and kidney and downregulated in 58% of liver cancer tissues from 60 Chinese patients, and four new homologs from other mammalians.
Gene
302
103-113
2003
530516
Ota T.,Suzuki Y.,Nishikawa T.,Otsuki T.,Sugiyama T.,Irie R.,Wakamatsu A.,Hayashi K.,Sato H.,Nagai K.,Kimura K.,Makita H.,Sekine M.,Obayashi M.,Nishi T.,Shibahara T.,Tanaka T.,Ishii S.,Yamamoto J.,Saito K.,Kawai Y.,Isono Y.,Nakamura Y.,Nagahari K.,Murakami K.,Yasuda T.,Iwayanagi T.,Wagatsuma M.,Shiratori A.,Sudo H.,Hosoiri T.,Kaku Y.,Kodaira H.,Kondo H.,Sugawara M.,Takahashi M.,Kanda K.,Yokoi T.,Furuya T.,Kikkawa E.,Omura Y.,Abe K.,Kamihara K.,Katsuta N.,Sato K.,Tanikawa M.,Yamazaki M.,Ninomiya K.,Ishibashi T.,Yamashita H.,Murakawa K.,Fujimori K.,Tanai H.,Kimata M.,Watanabe M.,Hiraoka S.,Chiba Y.,Ishida S.,Ono Y.,Takiguchi S.,Watanabe S.,Yosida M.,Hotuta T.,Kusano J.,Kanehori K.,Takahashi-Fujii A.,Hara H.,Tanase T.-O.,Nomura Y.,Togiya S.,Komai F.,Hara R.,Takeuchi K.,Arita M.,Imose N.,Musashino K.,Yuuki H.,Oshima A.,Sasaki N.,Aotsuka S.,Yoshikawa Y.,Matsunawa H.,Ichihara T.,Shiohata N.,Sano S.,Moriya S.,Momiyama H.,Satoh N.,Takami S.,Terashima Y.,Suzuki O.,Nakagawa S.,Senoh A.,Mizoguchi H.,Goto Y.,Shimizu F.,Wakebe H.,Hishigaki H.,Watanabe T.,Sugiyama A.,Takemoto M.,Kawakami B.,Yamazaki M.,Watanabe K.,Kumagai A.,Itakura S.,Fukuzumi Y.,Fujimori Y.,Komiyama M.,Tashiro H.,Tanigami A.,Fujiwara T.,Ono T.,Yamada K.,Fujii Y.,Ozaki K.,Hirao M.,Ohmori Y.,Kawabata A.,Hikiji T.,Kobatake N.,Inagaki H.,Ikema Y.,Okamoto S.,Okitani R.,Kawakami T.,Noguchi S.,Itoh T.,Shigeta K.,Senba T.,Matsumura K.,Nakajima Y.,Mizuno T.,Morinaga M.,Sasaki M.,Togashi T.,Oyama M.,Hata H.,Watanabe M.,Komatsu T.,Mizushima-Sugano J.,Satoh T.,Shirai Y.,Takahashi Y.,Nakagawa K.,Okumura K.,Nagase T.,Nomura N.,Kikuchi H.,Masuho Y.,Yamashita R.,Nakai K.,Yada T.,Nakamura Y.,Ohara O.,Isogai T.,Sugano S.
Complete sequencing and characterization of 21,243 full-length human cDNAs.
Nat. Genet.
36
40-45
2004
530517
Dunham A.,Matthews L.H.,Burton J.,Ashurst J.L.,Howe K.L.,Ashcroft K.J.,Beare D.M.,Burford D.C.,Hunt S.E.,Griffiths-Jones S.,Jones M.C.,Keenan S.J.,Oliver K.,Scott C.E.,Ainscough R.,Almeida J.P.,Ambrose K.D.,Andrews D.T.,Ashwell R.I.S.,Babbage A.K.,Bagguley C.L.,Bailey J.,Bannerjee R.,Barlow K.F.,Bates K.,Beasley H.,Bird C.P.,Bray-Allen S.,Brown A.J.,Brown J.Y.,Burrill W.,Carder C.,Carter N.P.,Chapman J.C.,Clamp M.E.,Clark S.Y.,Clarke G.,Clee C.M.,Clegg S.C.,Cobley V.,Collins J.E.,Corby N.,Coville G.J.,Deloukas P.,Dhami P.,Dunham I.,Dunn M.,Earthrowl M.E.,Ellington A.G.,Faulkner L.,Frankish A.G.,Frankland J.,French L.,Garner P.,Garnett J.,Gilbert J.G.R.,Gilson C.J.,Ghori J.,Grafham D.V.,Gribble S.M.,Griffiths C.,Hall R.E.,Hammond S.,Harley J.L.,Hart E.A.,Heath P.D.,Howden P.J.,Huckle E.J.,Hunt P.J.,Hunt A.R.,Johnson C.,Johnson D.,Kay M.,Kimberley A.M.,King A.,Laird G.K.,Langford C.J.,Lawlor S.,Leongamornlert D.A.,Lloyd D.M.,Lloyd C.,Loveland J.E.,Lovell J.,Martin S.,Mashreghi-Mohammadi M.,McLaren S.J.,McMurray A.,Milne S.,Moore M.J.F.,Nickerson T.,Palmer S.A.,Pearce A.V.,Peck A.I.,Pelan S.,Phillimore B.,Porter K.M.,Rice C.M.,Searle S.,Sehra H.K.,Shownkeen R.,Skuce C.D.,Smith M.,Steward C.A.,Sycamore N.,Tester J.,Thomas D.W.,Tracey A.,Tromans A.,Tubby B.,Wall M.,Wallis J.M.,West A.P.,Whitehead S.L.,Willey D.L.,Wilming L.,Wray P.W.,Wright M.W.,Young L.,Coulson A.,Durbin R.M.,Hubbard T.,Sulston J.E.,Beck S.,Bentley D.R.,Rogers J.,Ross M.T.
The DNA sequence and analysis of human chromosome 13.
Nature
428
522-528
2004
530519
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
Genome Res.
14
2121-2127
2004
530520
Ishikura S.,Usami N.,Araki M.,Hara A.
Structural and functional characterization of rabbit and human L-gulonate 3-dehydrogenase.
J. Biochem.
137
303-314
2005
530521
Burkard T.R.,Planyavsky M.,Kaupe I.,Breitwieser F.P.,Buerckstuemmer T.,Bennett K.L.,Superti-Furga G.,Colinge J.
Initial characterization of the human central proteome.
BMC Syst. Biol.
5
17-17
2011
530522
Bian Y.,Song C.,Cheng K.,Dong M.,Wang F.,Huang J.,Sun D.,Wang L.,Ye M.,Zou H.
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
J. Proteomics
96
253-262
2014