Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Ki Value [mM]

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search
Image of 2D Structure

Search term:

Results 1 - 8 of 8
download as CSV
download all results as CSV
EC Number Ki Value [mM] Ki Value maximum [mM] Inhibitor Commentary Reference
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.30-999 - more the Ki-value for 3-hydroxypyridine-2-carbonylglycine and N-((3-Hydroxy-6-chloroquinolin-2-yl)carbonyl)glycine are above 0.3 mM 659445
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.002 - oxalylglycine pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis 659445
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.01 - 3,4-dihydroxybenzoate pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis 659445
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.03 - Pyridine-2,4-dicarboxylate pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis 659445
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.05 - Pyridine-2,5-dicarboxylate pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis 659445
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.1 - DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis 659445
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.1 - PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis 659445
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.16 - ESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRAL pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis 659445
Results 1 - 8 of 8
download as CSV
download all results as CSV