Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 157 > >>
EC Number Substrates Commentary Substrates Organism Products Commentary (Products) Reversibility
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87Collagen + H2O - Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87DREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRA + H2O i.e. VWF74 peptide, a pseudo-wild-type peptide von Willebrand factor 74, VWF74, encompassing the von Willebrand factor, VWF, A2 domain sequence 1596-1669 Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87fluorescence resonance energy transfer substrate-von Willebrand factor 73 + H2O - Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87fluorescent resonance energy transfer-von Willebrand factor 73 + H2O - Rattus norvegicus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87FRET-VWF115 peptide + H2O von Willebrand factor-derived peptide substrate comprising residues 1554-1668 Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87FRET-VWF73 + H2O fluorogenic von Willebrand factor-derived peptide substrate. The distal C-terminal domains of ADAMTS13 are not necessary for the cleavage of the VWF73-based peptide substrate Mus musculus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87FRETS-rVWF71 + H2O substrate based on von Willebrand factor residues Gln1599-Arg1668, with an N-terminal Gly and with mutations N1610C and K1617R. The N-terminus is modified with IRDye QC-1 Nhydroxysuccinimide ester, and Cys1610 is modified with DyLight 633 maleimide Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87FRETS-von Willebrand factor 73 + H2O - Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87FRETS-vWF73 + H2O a fluorogenic von Willebrand factor-derived peptide substrate Homo sapiens ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.87FRETS-VWF73 peptide + H2O fluorogenic von Willebrand factor-derived peptide substrate Homo sapiens ? - ?
Results 1 - 10 of 157 > >>