Localization | Comment | Organism | GeneOntology No. | Textmining |
---|
Metals/Ions | Comment | Organism | Structure |
---|---|---|---|
Mg2+ | - |
Citrobacter rodentium ICC168 |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Citrobacter rodentium ICC168 | D2TNS3 | PhoPQ | - |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
ALYKKLLKKLLKSAKKLG + H2O | synthetic alpha-antimicrobial peptide L-C18G, D-amino acids are not degraded by CroP | Citrobacter rodentium ICC168 | ? | - |
? | |
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ + H2O | synthetic alpha-antimicrobial peptide CRAMP | Citrobacter rodentium ICC168 | ? | - |
? |
Synonyms | Comment | Organism |
---|---|---|
Citrobacter rodentium outer-membrane protease | - |
Citrobacter rodentium ICC168 |
Temperature Optimum [°C] | Temperature Optimum Maximum [°C] | Comment | Organism |
---|---|---|---|
37 | - |
assay at | Citrobacter rodentium ICC168 |
Organism | Comment | Expression |
---|---|---|
Citrobacter rodentium ICC168 | croP trancription is reduced in DELTAPhoPQ (two-component system composed of the sensor kinase PhoQ and the cognate response regulator PhoP), indicating that croP expression is partly under under the control of PhoP | down |
General Information | Comment | Organism |
---|---|---|
malfunction | deletion of croP in Citrobacter rodentium results in higher susceptibility to alpha-helical antimicrobial peptides, indicating a direct role of CroP in antimicrobial peptide resistance. Transcriptional activation of PhoP-regulated genes by alpha-helical antimicrobial peptides is restored in the croP mutant | Citrobacter rodentium ICC168 |
physiological function | CroP greatly contributes to the protection of the outer membrane from antimicrobial peptides damage by actively degrading alpha-helical antimicrobial peptides before they reach the periplasmic space. Resistance to alpha-helical antimicrobial peptides by the extracellular pathogen Citrobacter rodentium relies primarily on the CroP outer membrane protease | Citrobacter rodentium ICC168 |