Application | Comment | Organism |
---|---|---|
molecular biology | rhizopuspepsin is a good model enzyme to investigate acid proteinases | Rhizopus microsporus var. chinensis |
Cloned (Comment) | Organism |
---|---|
DNA sequence determination | Rhizopus arrhizus |
DNA sequence determination | Rhizopus niveus |
expresssion in Escherichia coli in inclusion bodies | Rhizopus microsporus var. chinensis |
Inhibitors | Comment | Organism | Structure |
---|---|---|---|
additional information | development of petidomimetic inhibitors | Rhizopus microsporus var. chinensis |
KM Value [mM] | KM Value Maximum [mM] | Substrate | Comment | Organism | Structure |
---|---|---|---|---|---|
0.0034 | - |
KPVSY(4-NO2-F)RL | - |
Rhizopus microsporus var. chinensis |
Localization | Comment | Organism | GeneOntology No. | Textmining |
---|---|---|---|---|
extracellular | the enzyme is secreted | Rhizopus arrhizus | - |
- |
extracellular | the enzyme is secreted | Rhizopus microsporus var. chinensis | - |
- |
extracellular | the enzyme is secreted | Rhizopus niveus | - |
- |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Rhizopus arrhizus | - |
- |
- |
Rhizopus microsporus var. chinensis | - |
- |
- |
Rhizopus niveus | - |
- |
- |
Purification (Comment) | Organism |
---|---|
native enzyme from culture medium | Rhizopus arrhizus |
native enzyme from culture medium | Rhizopus niveus |
native enzyme from culture medium by ammonium sulfate precipitation and pepstatin affinity chromatography, further separation of isozymes by isoelectric focusing, recombinant enzyme from Escherichia coli inclusion bodies | Rhizopus microsporus var. chinensis |
Renatured (Comment) | Organism |
---|---|
solubilization and refolding of recombinant enzyme from Escherichia coli inclusion bodies | Rhizopus microsporus var. chinensis |
Specific Activity Minimum [µmol/min/mg] | Specific Activity Maximum [µmol/min/mg] | Comment | Organism |
---|---|---|---|
additional information | - |
- |
Rhizopus microsporus var. chinensis |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O | i.e. insulin B chain, cleavage site specificity | Rhizopus arrhizus | L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA | - |
? | |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O | i.e. insulin B chain, cleavage site specificity | Rhizopus microsporus var. chinensis | L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA | - |
? | |
KPRRPYILKRGSYYY + H2O | synthetic neurotensin-like peptide, cleavage site specificity | Rhizopus microsporus var. chinensis | KPRRPYIL + KRGSYYY | - |
? | |
KPVSY(4-NO2-F)RL + H2O | - |
Rhizopus microsporus var. chinensis | ? | - |
? | |
additional information | very broad substrate specificity, overview | Rhizopus arrhizus | ? | - |
? | |
additional information | very broad substrate specificity, overview | Rhizopus microsporus var. chinensis | ? | - |
? | |
additional information | very broad substrate specificity, overview | Rhizopus niveus | ? | - |
? | |
Z-Ala-Ala-Lys-Ala-Ala-Ala + H2O | - |
Rhizopus microsporus var. chinensis | Z-Ala-Ala-Lys + Ala-Ala-Ala | - |
? |
Subunits | Comment | Organism |
---|---|---|
More | structure analysis | Rhizopus microsporus var. chinensis |
Synonyms | Comment | Organism |
---|---|---|
More | the enzyme belongs to the A1 peptidase family | Rhizopus arrhizus |
More | the enzyme belongs to the A1 peptidase family | Rhizopus microsporus var. chinensis |
More | the enzyme belongs to the A1 peptidase family | Rhizopus niveus |
Turnover Number Minimum [1/s] | Turnover Number Maximum [1/s] | Substrate | Comment | Organism | Structure |
---|---|---|---|---|---|
55 | - |
KPVSY(4-NO2-F)RL | - |
Rhizopus microsporus var. chinensis |
pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
---|---|---|---|
2.9 | 4.5 | varying maximum dependent on the substrate | Rhizopus microsporus var. chinensis |
Organism | Comment | pI Value Maximum | pI Value |
---|---|---|---|
Rhizopus microsporus var. chinensis | isozyme 1 | - |
5.1 |
Rhizopus microsporus var. chinensis | isozyme 2 | - |
5.8 |