Cloned (Comment) | Organism |
---|---|
- |
Homo sapiens |
Inhibitors | Comment | Organism | Structure |
---|---|---|---|
Co2+ | - |
Homo sapiens | |
additional information | inhibited by limited hypoxia | Homo sapiens | |
N-oxaloylglycine | - |
Homo sapiens | |
Zn2+ | - |
Homo sapiens |
KM Value [mM] | KM Value Maximum [mM] | Substrate | Comment | Organism | Structure |
---|---|---|---|---|---|
0.01 | - |
2-oxoglutarate | pH 7.4, 37°C | Homo sapiens | |
0.01 | - |
PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN | pH 7.4, 37°C | Homo sapiens |
Metals/Ions | Comment | Organism | Structure |
---|---|---|---|
Fe2+ | required | Homo sapiens |
Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
---|---|---|---|---|---|---|
hypoxia-inducible factor-L-asparagine + 2-oxoglutarate + O2 | Homo sapiens | activity of the hypoxia-inducible factor (HIF) complex is controlled by oxygen-dependent hydroxylation of prolyl and asparaginyl residues. Hydroxylation of specific prolyl residues by 2-oxoglutarate-dependent oxygenases mediates ubiquitinylation and proteasomal destruction of HIF-alpha. Hydroxylation of an asparagine residue (ASn803) in the C-terminal transactivation domain of HIF-alpha abrogates interaction with p300, preventing transcriptional activation | hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine + succinate + CO2 | - |
? |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Homo sapiens | - |
- |
- |
Purification (Comment) | Organism |
---|---|
- |
Homo sapiens |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
hypoxia-inducible factor-L-asparagine + 2-oxoglutarate + O2 | activity of the hypoxia-inducible factor (HIF) complex is controlled by oxygen-dependent hydroxylation of prolyl and asparaginyl residues. Hydroxylation of specific prolyl residues by 2-oxoglutarate-dependent oxygenases mediates ubiquitinylation and proteasomal destruction of HIF-alpha. Hydroxylation of an asparagine residue (ASn803) in the C-terminal transactivation domain of HIF-alpha abrogates interaction with p300, preventing transcriptional activation | Homo sapiens | hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine + succinate + CO2 | - |
? | |
hypoxia-inducible factor-L-asparagine + 2-oxoglutarate + O2 | the oxygen in the alcohol of the hydroxyasparagine residue is directly derived from dioxygen | Homo sapiens | hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine + succinate + CO2 | - |
? | |
PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN + 2-oxoglutarate + O2 | hypoxia-inducible factor-1alpha peptide 775-826. Mutation of Asn803 in GST-HIF-1alpha-(775826) to alanine, glutamine or glutamate abolishes activity, while an Asp803 mutant still supports some 2-oxoglutarate turnover, at a maximum of 7% of the analogous Asn-803 substrate | Homo sapiens | ? | - |
? |
Synonyms | Comment | Organism |
---|---|---|
factor inhibiting HIF | - |
Homo sapiens |
HIF asparagine hydroxylase | - |
Homo sapiens |
HIF asparaginyl hydroxylase | - |
Homo sapiens |
hypoxia-inducible factor asparagine hydroxylase | - |
Homo sapiens |
Temperature Optimum [°C] | Temperature Optimum Maximum [°C] | Comment | Organism |
---|---|---|---|
37 | - |
assay at | Homo sapiens |
pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
---|---|---|---|
7.4 | - |
assay at | Homo sapiens |
IC50 Value | IC50 Value Maximum | Comment | Organism | Inhibitor | Structure |
---|---|---|---|---|---|
0.01 | - |
- |
Homo sapiens | Zn2+ | |
0.01 | - |
- |
Homo sapiens | Co2+ | |
0.025 | - |
- |
Homo sapiens | N-oxaloylglycine |